Property Summary

NCBI Gene PubMed Count 23
PubMed Score 169.57
PubTator Score 25.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.583 4.3e-04
astrocytoma 1.900 4.2e-03
pancreatic ductal adenocarcinoma liver m... 1.139 3.1e-02
group 4 medulloblastoma 1.200 5.2e-06
subependymal giant cell astrocytoma -1.093 4.3e-02
ovarian cancer 2.000 6.2e-07

Gene RIF (8)

PMID Text
26947130 An isoform of BRD3, BRD3R (BRD3 with Reprogramming activity) is a reprogramming factor.
24565511 Here, we identify NCT, a complex comprising the Nrc1 BET-family tandem bromodomain protein (SPAC631.02), casein kinase II (CKII), and several TAFs, as a regulator of condensin function.
24049186 BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration.
22035730 The BRDT gene was not expressed in testicular tissue from patients with Sertoli cells only, whereas the other three genes of the BET family retained expression in all the sperm pathologies.
21555453 the structural basis for GATA1 and Brd3 interaction was described.
18406326 Results report that the double bromodomain proteins Brd2 and Brd3 associate preferentially in vivo with hyperacetylated chromatin along the entire lengths of transcribed genes.
17934517 BRD-NUT fusion proteins contribute to carcinogenesis by associating with chromatin and interfering with epithelial differentiation.
12371535 Activated lymphocytes induced by mitogens or antigens express various sets of genes, including those involved in the expression of cytokines, surface molecules, and nuclear proteins.

AA Sequence

MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNL      1 - 70
PDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQM     71 - 140
PQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTS    141 - 210
VPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRE    211 - 280
SGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHD    281 - 350
IIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV    351 - 420
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKK    421 - 490
KKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRQLKKGGKQASAS    491 - 560
YDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELE    561 - 630
RYVKSCLQKKQRKPFSASGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPS    631 - 700
RLSSSSSSESGSSSSSGSSSDSSDSE                                                701 - 726
//

Text Mined References (31)

PMID Year Title
26947130 2016 The acetyllysine reader BRD3R promotes human nuclear reprogramming and regulates mitosis.
24565511 2014 Identification of a BET family bromodomain/casein kinase II/TAF-containing complex as a regulator of mitotic condensin function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24049186 2013 Bromo- and extraterminal domain chromatin regulators serve as cofactors for murine leukemia virus integration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22035730 2012 Expression of BET genes in testis of men with different spermatogenic impairments.
21555453 2011 Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18406326 2008 The double bromodomain proteins Brd2 and Brd3 couple histone acetylation to transcription.
17934517 2008 BRD-NUT oncoproteins: a family of closely related nuclear proteins that block epithelial differentiation and maintain the growth of carcinoma cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16008511 2005 Differentially expressed genes in endothelial differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12600283 2003 [Expression of BRD7-interacting proteins,BRD2 and BRD3, in nasopharyngeal carcinoma tissues].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371535 2002 Detection of the genes induced in activated lymphocytes by modified differential display.
9373153 1997 Chromosomal localization, gene structure and transcription pattern of the ORFX gene, a homologue of the MHC-linked RING3 gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8781126 1996 Phylogeny and structure of the RING3 gene.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.