Property Summary

NCBI Gene PubMed Count 58
PubMed Score 0.00
PubTator Score 345.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.400 5.2e-03
osteosarcoma 1.447 5.2e-04
astrocytoma 1.600 8.5e-03
juvenile dermatomyositis 1.438 4.4e-10
acute quadriplegic myopathy 1.029 5.2e-04
pancreatic ductal adenocarcinoma liver m... 2.177 3.9e-03
primary Sjogren syndrome -1.100 1.1e-02
acute myeloid leukemia 1.100 3.7e-03
ovarian cancer 2.400 8.5e-07
dermatomyositis -1.200 4.1e-04

Gene RIF (43)

PMID Text
26586120 LRP1B, BRD2 and CACNA1D are new candidate genes in fetal metabolic programming of newborns exposed to maternal hyperglycemia.
26324948 This study implicates BET Brds as important regulators of IkappaB kinase/NF-kappaB-mediated synovial inflammation of RA and identifies BET proteins as novel therapeutic targets in inflammatory arthritis.
25049379 An unexpected role for the bromodomain and extraterminal domain (BET) proteins BRD2 and BRD4 in maintaining oncogenic IKK activity in activated B-cell-like diffuse large B-cell lymphoma.
24733848 BET proteins, particularly Brd2 and Brd4, may play a key role in the regulation of Nrf2-dependent antioxidant gene transcription and are hence an important target for augmenting antioxidant responses in oxidative stress-mediated diseases.
24146614 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24049186 BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration.
24048450 The C-terminal domain of Brd2 is important for chromatin interaction and regulation of transcription and alternative splicing.
23756480 The SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myoclonic epilepsy'
23255218 our results identify BRD2 as a new Tat-independent suppressor of HIV transcription in latently infected cells and underscore the therapeutic potential of BET inhibitors in the reversal of HIV latency.
23115324 Brd2 and Brd4 proteins mediatE the responses of LFs after growth factor stimulation and drivE the induction of lung fibrosis in mice in response to bleomycin challenge.
22766109 Our study did not confirm the presence of the genetic variants previously found to link the BRD2 gene to the idiopathic form of photosensitive epilepsy.
22035730 The BRDT gene was not expressed in testicular tissue from patients with Sertoli cells only, whereas the other three genes of the BET family retained expression in all the sperm pathologies.
21608014 The bromodomain-containing gene BRD2 is regulated at transcription, splicing, and translation levels.
20709061 the crystal structure of the second bromodomain of BRD2 (BRD2-BD2) in complex with the di-acetylated histone H4 tail (H4K5ac/K12ac) was shown.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20048151 Data report the crystal structures of the N-terminal bromodomain of human BRD2 (BRD2-BD1; residues 74-194) in complex with each of three different Lys-12-acetylated histone H4 peptides.
20036832 Studies indicate that KSHV LANA interacts with Brd2 and Brd4.
19953286 no difference was observed in the allele and genotype frequencies of BRD2 between juvenile myoclonic epilepsy (JME) and controls
19953286 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18406326 Results report that the double bromodomain proteins Brd2 and Brd3 associate preferentially in vivo with hyperacetylated chromatin along the entire lengths of transcribed genes.
17999746 study investigated the SNP markers (rs188254, rs206781, and rs516535) in the 3'-end of the BRD2 and found no significant difference between the allele frequencies in epilepsy cases and controls
17848202 The second bromodomain of Brd2 binds histone H4 acetyl-lysine K12.
17848202 Brd2 bromodomain 2 is monomeric in solution and dynamically interacts with H4-AcK12; additional secondary elements in the long ZA loop may be a common characteristic of BET bromodomains.
17166848 Brd2-driven B cell lymphomas exhibit a transcriptional signature of diffuse large B cell lymphoma, and show differential expression of genes involved in normal proliferation, as well as several novel, tumor-specific genes.
17148447 Brd2 associates with the transcription factor E2F, the Mediator components CDK8 and TRAP220, RNA polymerase II on chromatin; and associates with acetylated histone H4 through its bromodomains.
17148447 Two acetyllysine-binding pockets and a negatively charged secondary binding pocket, produced at the dimer interface in BRD2 bromodomain 1 (BD1), may be the unique features that allow BRD2 BD1 to selectively bind to the acetylated histone H4 tail.
17111193 Brd2 is a novel protein kinase that plays a role in cell cycle-responsive transcription, recruiting E2F1, TATA Box Binding Protein and histone acetylase activity to E2F-responsive promoters in response to mitogenic stimuli.
16940503 there are distinct functional roles for the two bromodomain proteins RING3/Brd2 and Brd4 in LANA binding
16786191 The results showed that BRD7 could interact with BRD2 and the region from amino acid 430 to 798 of BRD2 was critical for the interaction of BRD2 with BRD7. BRD2 mainly localizes in nucleus and BRD2 has distinct roles in initiating apoptosis.
16516380 Observational study of gene-disease association. (HuGE Navigator)
16516380 Present results support evidence that photoparoxysmal response and Myoclonic Epilepsy, Juvenile share epileptogenic pathways, for which BRD2 might be an underlying susceptibility gene.
16512664 Evidence from transgenic mice suggests that Brd2 transactivates the cyclin A locus, and that overexpression increases cyclin A transcription, destabilizing the cell cycle.
15548137 Brd2, a nuclear-localized protein kinase, binds to cyclin A promoter chromatin and recruits histone H4-specific acetylase activity, increasing cyclin A transcription and accelerating S phase entry in fibroblasts.
14563639 B cell-restricted expression of Brd2 in transgenic mice upregulates cyclin A trancription even in mitogenically unstimulated B cells and causes lymphoma with a B1a-like immunophenotype, accompanied by peripheral B cell leukemia.
12830434 highly significant linkage disequilibrium between juvenile myoclonic epilepsy and a core haplotype of five single-nucleotide-polymorphism and microsatellite markers in chromosomal region 6p21
12366783 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12145330 immunoblot and immunoprecipitation experiments to identify proteins interacting with Fsrg1 and RING3
11983150 The BRD2 gene is located within the human class II major histocompatibility complex at Chromosome 6p21.3, but appears to have no role in antigen processing, and is likely involved in signal transduction and transcription.
10965846 Brd2 protein participates in a nuclear complex that contains E2Fs. Overexpression of Brd2 protein with oncogenic ras transactivates E2F-dependent promoters of the cell cycle regulatory genes dihydrofolate reductase, cyclin D1, cyclin A and cyclin E.
10934046 Mitogenic stimuli induce nuclear localization of Brd2 protein.
8595877 The BRD2 gene is homologous to the mammalian cell cycle regulator TAFII250 and the Drosophila trithorax group gene female sterile homeotic; the gene encodes a nuclear-localized kinase with signal transduction activity.

AA Sequence

MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPK      1 - 70
KPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASE     71 - 140
CMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVT    141 - 210
SAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVK    211 - 280
RKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQL    281 - 350
KHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL    351 - 420
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEESSSESS    421 - 490
SEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA    491 - 560
EKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTG    561 - 630
YDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELE    631 - 700
RYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVA    701 - 770
VSRLSASSSSSDSSSSSSSSSSSDTSDSDSG                                           771 - 801
//

Text Mined References (69)

PMID Year Title
26586120 2015 LRP1B, BRD2 and CACNA1D: new candidate genes in fetal metabolic programming of newborns exposed to maternal hyperglycemia.
26324948 2016 Bromodomain and extra-terminal domain bromodomain inhibition prevents synovial inflammation via blocking I?B kinase-dependent NF-?B activation in rheumatoid fibroblast-like synoviocytes.
25049379 2014 Blockade of oncogenic I?B kinase activity in diffuse large B-cell lymphoma by bromodomain and extraterminal domain protein inhibitors.
24733848 2014 Bromodomain and extraterminal proteins suppress NF-E2-related factor 2-mediated antioxidant gene expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24229708 2013 Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
24146614 2013 A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins.
24049186 2013 Bromo- and extraterminal domain chromatin regulators serve as cofactors for murine leukemia virus integration.
24048450 2013 The C-terminal domain of Brd2 is important for chromatin interaction and regulation of transcription and alternative splicing.
23756480 2013 The quest for juvenile myoclonic epilepsy genes.
23255218 2013 BET bromodomain-targeting compounds reactivate HIV from latency via a Tat-independent mechanism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115324 2013 BET bromodomain proteins mediate downstream signaling events following growth factor stimulation in human lung fibroblasts and are involved in bleomycin-induced pulmonary fibrosis.
22766109 2012 Bromodomain-containing protein 2 gene in photosensitive epilepsy.
22035730 2012 Expression of BET genes in testis of men with different spermatogenic impairments.
21608014 2011 The bromodomain-containing gene BRD2 is regulated at transcription, splicing, and translation levels.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20871596 2010 Selective inhibition of BET bromodomains.
20709061 2010 Structural implications for K5/K12-di-acetylated histone H4 recognition by the second bromodomain of BRD2.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048151 2010 Structural basis for acetylated histone H4 recognition by the human BRD2 bromodomain.
20036832 2010 WHAT do viruses BET on?
19953286 2010 BRD2 and TAP-1 genes and juvenile myoclonic epilepsy.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18406326 2008 The double bromodomain proteins Brd2 and Brd3 couple histone acetylation to transcription.
17999746 2007 Association analysis of BRD2 (RING3) and epilepsy in a Dutch population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17848202 2007 Solution structure of the second bromodomain of Brd2 and its specific interaction with acetylated histone tails.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17166848 2007 Tumor-specific and proliferation-specific gene expression typifies murine transgenic B cell lymphomagenesis.
17148447 2007 Crystal structure of the human BRD2 bromodomain: insights into dimerization and recognition of acetylated histone H4.
17111193 2007 Brd2 is a TBP-associated protein and recruits TBP into E2F-1 transcriptional complex in response to serum stimulation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16940503 2006 Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen interacts with bromodomain protein Brd4 on host mitotic chromosomes.
16786191 2006 BRD2 is one of BRD7-interacting proteins and its over-expression could initiate apoptosis.
16516380 2006 Association of BRD2 polymorphisms with photoparoxysmal response.
16512664 2006 Identification of transcription complexes that contain the double bromodomain protein Brd2 and chromatin remodeling machines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15548137 2005 Bromodomain analysis of Brd2-dependent transcriptional activation of cyclin A.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14731392 2004 Selective recognition of acetylated histones by bromodomain proteins visualized in living cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14563639 2004 E mu-BRD2 transgenic mice develop B-cell lymphoma and leukemia.
12830434 2003 BRD2 (RING3) is a probable major susceptibility gene for common juvenile myoclonic epilepsy.
12600283 2003 [Expression of BRD7-interacting proteins,BRD2 and BRD3, in nasopharyngeal carcinoma tissues].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12366783 2002 Susceptibility locus for non-obstructive azoospermia is localized within the HLA-DR/DQ subregion: primary role of DQB1*0604.
12145330 2002 Reproductive cycle regulation of nuclear import, euchromatic localization, and association with components of Pol II mediator of a mammalian double-bromodomain protein.
11983150 2002 Genetic control of MHC class II expression.
11502199 2001 Identification and cloning of an 85-kDa protein homologous to RING3 that is upregulated in proliferating endothelial cells.
10965846 2000 RING3 kinase transactivates promoters of cell cycle regulatory genes through E2F.
10934046 2000 Activation-induced nuclear translocation of RING3.
9693039 1998 Nucleotide sequence of the ring3 gene in the class II region of the mouse MHC and its abundant expression in testicular germ cells.
9373153 1997 Chromosomal localization, gene structure and transcription pattern of the ORFX gene, a homologue of the MHC-linked RING3 gene.
8781126 1996 Phylogeny and structure of the RING3 gene.
8595877 1996 A novel, mitogen-activated nuclear kinase is related to a Drosophila developmental regulator.
1663500 1991 Orientation of HLA-DNA gene and identification of a CpG island-associated gene adjacent to DNA in human major histocompatibility complex class II region.
1352711 1992 A homologue of the Drosophila female sterile homeotic (fsh) gene in the class II region of the human MHC.
1350857 1992 The bromodomain: a conserved sequence found in human, Drosophila and yeast proteins.