Property Summary

Ligand Count 206
NCBI Gene PubMed Count 60
PubMed Score 0.00
PubTator Score 345.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.100 3.7e-03
acute quadriplegic myopathy 1.029 5.2e-04
astrocytoma 1.500 1.3e-02
dermatomyositis -1.200 4.1e-04
juvenile dermatomyositis 1.438 4.4e-10
osteosarcoma 1.447 5.2e-04
ovarian cancer 2.100 4.9e-06
pancreatic ductal adenocarcinoma liver m... 1.114 2.1e-02
primary Sjogren syndrome -1.100 1.1e-02
Rheumatoid arthritis 1.400 5.2e-03

PDB (47)

Gene RIF (45)

AA Sequence

MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPK      1 - 70
KPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASE     71 - 140
CMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVT    141 - 210
SAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVK    211 - 280
RKADTTTPTPTAILAPGSPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQL    281 - 350
KHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL    351 - 420
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSESSSEESSSESS    421 - 490
SEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPISKPKRKREKKEKKKKRKA    491 - 560
EKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLPKKATKTAPPALPTG    561 - 630
YDSEEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELE    631 - 700
RYVLSCLRKKPRKPYTIKKPVGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVA    701 - 770
VSRLSASSSSSDSSSSSSSSSSSDTSDSDSG                                           771 - 801
//

Text Mined References (71)

PMID Year Title