Property Summary

NCBI Gene PubMed Count 1,399
PubMed Score 2495.56
PubTator Score 3142.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 6.971 3.5
Fanconi's anemia 50 0.0 4.0

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 3.900 1.3e-07
osteosarcoma 1.478 2.5e-02
glioblastoma 1.500 1.9e-04
sonic hedgehog group medulloblastoma 2.200 6.3e-08
atypical teratoid/rhabdoid tumor 1.800 1.2e-08
medulloblastoma, large-cell 2.100 5.5e-07
primitive neuroectodermal tumor 1.900 1.4e-04
colon cancer 2.300 3.6e-02
lung cancer 1.500 4.5e-03
pediatric high grade glioma 1.400 3.2e-05
non primary Sjogren syndrome sicca -1.100 2.4e-02
lung carcinoma -1.100 1.2e-15
psoriasis 1.300 1.1e-48

Gene RIF (1482)

PMID Text
27002934 BRCA2 mutation is associated with breast and ovarian cancer.
26997744 Findings show eight distinct pathogenic mutations in eight unrelated families and suggest that BRCA1/2 mutations are responsible for a significant proportion of hereditary and sporadic breast cancer among Algerian young women.
26989051 Comparison of male breast cancer tumors with female breast cancer tumors demonstrates that male breast cancer tumors arise more frequently from BRCA2 mutations and less frequently from BRCA1 mutations than female breast cancer tumors.
26979245 The rs144848 mutation of BRCA2 may have a protective effect against lung cancer among women
26976601 BRCA2 protein stimulates DMC1-mediated DNA strand exchange between RPA-ssDNA complexes and duplex DNA, thus identifying BRCA2 as a mediator of DMC1 recombination function.
26888723 The study concluded that true HER2-amplified breast cancers are rare amongst BRCA1 mutation carriers and are less common in BRCA2 than background rates
26859126 BRCA2 germ-line mutation is associated with neoplasm recurrence in breast cancer patients.
26857456 BRCA1/2 male breast cancers display distinct pathologic characteristics compared with BRCA1/2 female breast cancers , and we identified a specific BRCA2-associated MBC phenotype characterised by a variable suggesting greater biological aggressiveness
26852015 BRCA1 and BRCA2 mutations accounted for a considerable proportion of hereditary breast/ovarian cancer patients from eastern China and the spectrum of the mutations of these two genes exhibited some unique features
26842001 Lung adenocarcinomas in both male and female patients were associated with (a) genotypic polymorphisms of FANCC and FANCD1.
26833090 Results show that XPG partners with BRCA1 and BRCA2 to maintain genomic stability through homologous recombination, and its loss causes DNA breaks, chromosome aberrations, and replication fork stalling.
26780556 The RNA effect of 28 BRCA1 and BRCA2 VUS identified in our set of HBOCS families.
26775038 BRCA2 protein expression at the cell membrane and lack of C-terminal expression in the cytoplasm were associated with a reduced risk of rapidly fatal prostate cancer
26750490 After miR-17-5p transfection, cell proliferation, migration, invasion and tumorigenesis in the osteosarcoma cells were significantly promoted. We further demonstrated that BRCC2 is a direct target of miR-17-5p.
26749359 39 were BRCA1/2 mutation carriers.
26748828 G4-quadruplex stabilizing drugs target tumors with BRCA1/2 deficiencies.
26745123 Hypermethylation and low Expression of BRCA2 is associated with Epithelial Ovarian Cancers
26700119 BRCA2 Mutation is associated with Breast Cancer.
26698676 Treatment for infertility does not significantly increase the risk of ovarian cancer among women with a BRCA2 mutation.
26638190 The strongest predictors are the BRCA2 mutations, and the highly penetrant G84E mutation in HOXB13
26629528 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-kappaB Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers
26625823 study to estimate the carrier frequency of BRCA1 185delAG and BRCA2 6174delT mutations in eastern Indian breast cancer patients; findings suggest that these BRCA mutations may not have a strong recurrent effect on breast cancer among the eastern Indian populations
26588056 Studies suggest that the clinical management of cancer risk in breast cancer 1/2 proteins (BRCA1 and BRCA2) mutation carriers is complex and should consider patient preferences.
26586665 The K3326X variant of BRCA2 is associated with risk of developing breast and ovarian cancers independent of other pathogenic variants in BRCA2.
26584049 Using human and murine cells defective in FANCD2 or FANCA and primary bone marrow cells derived from FANCD2 deficient mice, we show that the FA pathway removes R loops and that many DNA breaks accumulated in FA cells are R loop-dependent.
26577449 The aim of this study was to determine the frequency and spectrum of germline mutations in BRCA1, BRCA2 and PALB2 and to evaluate the presence of the CHEK2 c.1100delC allele in these patients.
26574845 Recognition of different invasion patterns of metastatic extrauterine high grade serous carcinoma with BRCA germline mutations has prognostic implications.
26543556 DNA from 120 subjects was used to sequence the entirety of BRCA1 and BRCA2 coding regions and splice sites, and validate pathogenic mutations, with a total material cost of $85/subject. Subjects ranged in age from 23 to 81 years
26496879 BRCA1-associated DCIS did not express ER, PR or HER2, while most BRCA2-associated DCIS did express ER and PR. BRCA1- as well as BRCA2-associated DCIS had expression of HER3 and C-MET
26496279 the N372H polymorphism is associated with susceptibility of ovarian cancer (Meta-Analysis)
26489613 There was no significant difference in disease-free survival between BRCA2 mutation carriers and patients with sporadic disease. (Review, meta-analysis)
26483394 BRCA2 mutation is associated with Pancreatic Cancer.
26467044 In this cohort of BRCA1/2-associated breast cancer (BC) patients, no association between radiotherapy for primary BC and risk of (BC) contralateral breast cancer was observed in the total group, nor in the patients irradiated before the age of 40 years
26467043 Risk assessment for healthy BRCA2 mutation carriers should consider the ages of breast cancers diagnosed in first-degree relatives
26455428 The BRCA2 rs11571833, an A > T transversion in the final exon is the risk allele for the development of a familial breast cancer.
26439132 In this unselected Japanese population, approximately 13% of the cases with ovarian cancer appeared to be associated with an inherited risk, BRCA1/2 mutation, regardless of a family history.
26438354 BRCA2 mutation is associated with breast and ovarian Neoplasms.
26402875 BRCA2 mutation is associated with Korean ovarian cancer.
26378051 BRCA2 mutation is associated with invasive breast cancer.
26347108 BRCA2-mutated prostate cancer patients have an adverse prognosis and poor outcome compared to non-mutated.
26335130 BRCA2 mutation carriers demonstrated normal ovarian response in IVF cycles.
26254840 BRCA2 mutation is associated with Breast Cancer.
26239694 BRCA2 single nucleotide polymorphism is associated with ontralateral breast cancer.
26225655 Mutation in the BRCA2 gene is associated with Breast and/or Ovarian Cancers.
26219241 BRCA2 Mutation is associated with Breast Cancer.
26195121 Breast cancer risk for Korean women with germline mutations in BRCA2.
26183948 Mutation profile of the BRCA1/2 genes in breast cancer Bulgarian patients show 13 disease causing mutations with 4 new. Mutations in BRCA1 gene were found in 14% and in BRCA2, in 5.5% of the cases. The inherited predisposition was identified in 19.5%.
26181175 Did not observe a significant decline in mortality associated with oophorectomy in breast cancer patients with BRCA2 mutations. b
26153499 BRCA2 mutation is associated with breast and ovarian cancers.
26145171 by targeting RPA and mimicking DNA, DSS1 functions with BRCA2 in a two-component homologous recombination mediator complex in genome maintenance and tumor suppression
26111274 BRCA2 Arg372His polymorphism is not associated with ovarian cancer risk.
26047126 BRCA mutations that survive selection pressure seem to provide significant fertility advantages.
26028024 Breast and ovarian cancer predisposition due to de novo BRCA1 and BRCA2 mutations
26026974 BRCA2 mutation is associated with familial breast and ovarian cancer syndrome.
26006218 IGF1 level is significantly lower in cancer-free BRCA mutation carriers versus BRCA-negative controls, and there is a potential association between estradiol and IGF1 in cancer-free BRCA mutation carriers
25980896 BRCA2 mutation is associated with ovarian cancer.
25971625 the prevalence of BRCA1 and BRCA2 mutations is high in triple-negative breast cancer patients and BRCA1/2 mutations are not restricted to young women or patients with a positive family history.
25948675 Men carrying genetic mutations in the BRCA gene( BRCA1 and BRCA2) have a greater risk than the general population of developing certain types of cancer, including breast, pancreatic, and prostate cancer.
25948282 analysis of novel A1/2 mutations in Polish patients with familial breast/ovarian cancer
25940717 Pathogenic BRCA1/2 mutations were identified in 4.6% of a large cohort of clinic-based pancreatic adenocarcinoma patients.
25927241 In response to replication stress, BRCA2 recruits RAD51 onto nascent DNA at stalled forks, protecting nascent DNA from nucleolitic cleavage.
25919761 differences in associations of common breast cancer susceptibility alleles between BRCA1 and BRCA2 carriers and the general population are explained to a large extent by differences in the prevalence of ER-positive and ER-negative tumors
25892146 Women with mutations in BRCA1 and BRCA2 have different risks of developing ovarian and breast cancer, depending on the nature of the mutations
25879355 Our results demonstrate in a subset of cases that decline in BRCA1 expression that may be associated with potentially compensatory increase in BRCA2 protein, which may depend on tumor grade as well as menopausal status.
25869530 A rare BRCA2 genetic variant, known as rs11571833 (K3326X), is strongly associated with squamous-cell cancers of the upper aerodigestive tract (UADT)
25868867 our findings demonstrate that among young Black breast cancer survivors, socioeconomic factors and physician referral patterns contribute to disparities in access to BRCA testing(BRCA1 and BRCA2 mutation detection)
25865228 Report autoimmune response to BRCA2 in tumors.
25863477 From an analysis of the mutation spectrum, 63 BRCA1 and 90 BRCA2 different mutations, including 44 novel mutations, were identified.BRCA mutations in familial breast cancer patients is similar to that among Western cohorts
25850293 The Russian carriers of BRCA1, BRCA2 and CHEK2 germline mutations have genetic predisposition to breast, ovarian, and colorectal cancer.
25849179 Breast and ovarian cancer risks varied by type and location of BRCA1/2 mutations. With appropriate validation, these data may have implications for risk assessment and cancer prevention decision making for carriers of BRCA1 and BRCA2 mutations.
25838448 The study found a robust association between a truncating BRCA2 variant and upper aerodigestive tract cancer risk.
25833210 Two novel heterozygous mutations predicted to alter the function of PALB2 were identified (c.2014G>C, p.E672Q and c.2993G>A, p.G998E). Notably, both of these mutations co-existed in BRCA1 and BRCA2 families
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25824734 Mutations in BRCA2 gene is associated with breast cancer.
25821000 BRCA2 gene mutation is associated with breast cancer.
25816289 BRCA2 mutation carriers are not associated with worse breast cancer prognosis.
25808098 BRCA2 mutation is associated with breast cancer.
25803638 By binding and destabilizing a histone acetyltransferase, p300, beta-HPV 5 and 8 E6 reduce the enrichment of the transcription factor at the promoter of two genes critical to the homology dependent repair of DSBs (BRCA1 and BRCA2)
25792249 Fertility treatments are not associated with an increased risk of invasive epithelial ovarian cancer in Jewish Israeli BRCA1/2 mutation carriers.
25788227 Study shows that Jewish BRCA1/2 mutation carriers are at an increased risk for breast and pancreatic, but not prostate cancer.
25777348 A prevalence rate of 5.6% for having deleterious BRCA1 or BRCA2 mutations among Lebanese Arab women with breast cancer
25756400 BRCA1 gene mutation is associated with gynecologic cancer.
25749384 FBN1 acts downstream of Aur A and BRCA2, promoting ovarian cancer metastasis through p53 and SLUG-associated signaling.
25743105 acinar cell carcinomas show a distinct mutation pattern and often harbor somatic or germline mutations of BRCA2 and FAT genes.
25736863 BRCA2 tumors were more likely to be ER and HER2 positive than other non-BRCA familial breast cancers.
25736055 FANCD1 plays a role in gemcitabine drug resistance in biliary tract cancer.
25735359 BRCA2 gene mutations are associated with breast cancer.
25734415 Localized correlated spectroscopy recorded significant changes in women with BRCA1 and BRCA2 gene mutations when compared with control subjects. If these changes are ultimately proven to be a premalignant stage, this method may prove useful in screening
25682074 study identified a BRCA1 or BRCA2 germline mutation in 74 of 774 (9.6 %) triple-negative breast cancer patients; mutation prevalence was 9.3 % in Australia and was 9.9 % in Poland
25675043 BRCA2 gene mutation is associated with breast cancer.
25659033 FANCJ and BRCA2 share FANCD2's role in replication fork restart.
25639900 Studies indicate that each of the three neoplasm protein variants in BRCA1, BRCA2 and MSH2 would normally be reported as pathogenic based on widely accepted guidelines.
25613119 Taking into account modifier factors, location of mutation might be important for the clinical management of BRCA1/2 mutation carriers.
25586199 The deletion c.1792delA, in exon 10, and the duplication c.5869dupA, in exon 11 of BRCA2 are novel mutations in Spanish breast cancer patients.
25581732 Report roles BRCA1 status and tubual intraepithelial carcinoma on prognosis in women with high grade serous carcinoma.
25537514 Data indicate that three microRNAs hsa-miR-146a, hsa-miR-148a and hsa-miR-545 targeting BRCA1/2 and were associated with overall survival and progression-free survival in patients with wild-type BRCA1/2.
25526195 Germline mutations in DICER1 are rare or absent in familial breast cancer patients with BRCA1/BRCA2-negative familial breast cancers.
25522926 Tumor-associated inflammation density was the strongest predictor for recurrence-free survival in this series of BRCA1/2 breast cancer patients
25503500 BRCA1/BRCA2 mutation carriers experienced a sense of disorientation about the most appropriate way of dealing with genetic risk
25486196 Fresh insight into the mechanism by which the HMG20b-BRCA2 complex controls mitotic cell division, and implicate heterozygous HMG20b mutations affecting cytokinesis regulation in the genesis of human cancers
25476495 Non-founder mutations make up between 7.2 and 13.0 % of all BRCA1 and BRCA2 mutations in Ashkenazi Jews. A wide range of mutations are present, most of which are also seen in non-AJ individuals
25454609 Prostate cancer patients with germline BRCA mutations had worse outcomes than noncarriers when conventionally treated with surgery or radiation therapy.
25445393 The study shows evidence of the modulation effect of BRCA mutation on the expression of microRNA-200c in Triple negative breast cancer progression.
25437005 genomic instability score in discriminating nonequivalent outcomes of BRCA1/2 mutations and in predicting outcomes of ovarian cancer treated with platinum-based chemotherapy
25428789 Mutations in BRCA1 and BRCA2 or another breast cancer gene occur in one in four African American breast cancer patients with early onset disease, family history of breast or ovarian cancer, or TNBC
25418591 targeting relevant exons in BRCA1 and BRCA2 genes allows detection of a substantial percentage of mutations in the Tunisian population.
25398451 analysis of effect of germline mutations in BRCA1 and BRCA2 on mortality in ovarian cancer patients; BRCA1/2 mutations are associated with better short-term survival, but this advantage decreases over time and, in BRCA1 carriers is eventually reversed
25395318 Our data provide initial evidence for a novel putative ovarian cancer cluster region in BRCA2 exons 13-14.
25382762 Identification of pathogenic BRCA2 variants resulting in alternative splicing.
25380576 BRCA2 polymorphisms show no detectable endometriosis risk in Indian population.
25356972 Germ-line DNA samples from 727 unrelated probands with positive family history (521 met criteria for familial pancreatic cancer) were tested for mutations in BRCA1 and BRCA2, PALB2, and CDKN2A.
25348552 Well-designed and large-scale studies are needed to substantiate the association between BRCA2 N372H polymorphism and cancer risk.
25348513 Our analyses suggest that BRCA mutations(BRCA1 and BRCA2) are robust predictors of outcomes in both ovarian and breast cancers and these mutations should be taken into account when devising appropriate therapeutic strategies
25342642 BRCA2 mutation is associated with triple-negative breast cancer.
25311111 BRCA2 mutation is associated with breast and ovarian cancer.
25282148 BRCA2 exists as a dimer and that two oppositely oriented sets of RAD51 molecules bind the dimer RAD51 to facilitate rad51-mediated homologous-recombinational repair.
25267367 We hereby report two cases of male breast cancer with neurofibromatosis.
25257187 The observed rate of 3 of 5754 cases (0.052%) of head and neck cancers in BRCA-positive probands warrants further investigation into the nature of a possible linkage between germline BRCA mutations and salivary gland cancer.
25251729 The observed age difference may allow a greater understanding of mechanisms associated with the differences in cancer penetrance in BRCA1/2 mutation carriers, some of which may depend on paternal origin.
25243787 BRCA2 rs10492396 (AG vs. GG: adjusted hazard ratio (adjHR)=1.85, 95% confidence interval (CI)=1.16-2.95, P=0.010), rs206118 (CC vs. TT+TC: adjHR=2.44, 95% CI=1.27-4.67, P=0.007), rs3752447 and FANCA rs62068372
25218637 Data indicate that tumour suppressor RASSF1A triggers large tumor suppressor kinase 1 (LATS)-CDK2 interaction and restricts CDK2 kinase activity towards BRCA2.
25195694 the analysis of studies to date that have evaluated the risk of BRCA1 and BRCA2 mutations for colorectal cancer (Review)
25176351 Study showed that large genomic rearrangements were found in 3.7% of the patients who had mutations in BRCA1 or BRCA2, and 7.5% of patients with mutations in BRCA1 only.
25154786 conclude that the woman has two potential disease-causing mutations and that predictive testing of family members should include both the RAD51C and BRCA2 mutation
25154392 BRCA2 mutated intraductal carcinoma of the prostate is common in patients with familial prostate cancer and is associated with poor outcomes.
25136623 This review is aimed at exploring the current knowledge on epidemiological and molecular aspects of BRCA-associated (BRCA1 and BRCA2 ) Ovarian cancer predisposition
25112434 BRCA2 mutation carriers are at risk for multiple cancers, including contralateral breast cancer
25111659 Five BRCA2 mutations and ten variants of unknown significance (VUS) were identified in familial and aggressive prostate cancer.
25101567 The survival of men with screen-detected prostate cancer and a BRCA2 mutation is much poorer than expected.
25099575 Loss-of-function mutations in PALB2 are an important cause of hereditary breast cancer. Our data suggest the breast-cancer risk for PALB2 mutation carriers may overlap with that for BRCA2 mutation carriers.
25085752 BRCA2 mutation is associated with breast cancer.
25082516 BRCA2 mutation is associated with breast cancer.
25070656 BRCA1 and BRCA2 contribute to a genetic predisposition for breast cancer.
25066507 Genetic analysis revealed 32 different pathogenic germline BRCA1/2 mutations: 20 in the BRCA1 gene and 12 in the BRCA2 gene, including four different large genomic rearrangements in the BRCA1 gene.
25053764 Prospective breast cancer risks in women in the UK are high especially for BRCA2 families ascertained on the basis of high risk.
25047474 Mutations in the BRCA2 gene is associated with breast and ovarian cancer.
25047471 BRCA2 mutation is not associated with nodal metastasis in breast cancer.
25043256 BRCA2 directly represses the expression of IFN-related genes
25036526 absence of BRCA/FMR1 correlations in women with ovarian cancers
25011685 Exon 11 of BRCA2, an important genetic determinant for hereditary breast and ovarian cancers, was sequenced from diverse primate species including humans; found that this gene, like BRCA1, bears the surprising signature of positive selection.
24996439 Data suggest that the Fanconi anemia group F protein/BRCA1/2 proteins pathway may be a new target to reverse adriamycin (ADR) resistance in leukemia treatment.
24951607 Intentions to undergo PND or PGD do not appear to change after disclosure of BRCA results. Additional counseling for patients who have undergone BRCA testing may be warranted to educate patients about available fertility preservation options.
24947112 conclude that contralateral risk-reducing mastectomy is associated with improved overall survival in BRCA1/2 mutation carriers with a history of primary breast cancer
24938600 Stratification of patients and controls based on gender revealed no association between rs1799943 of the BRCA2and the risk of CVD in either gender.
24902638 BRCA2 protein is modulator of anoikis sensitivity through an evolutionarily-conserved molecular mechanism involving regulation of reactive oxygen spessies production and/or detoxification by BRCA2 during PCD processes.
24896180 TREX-2 complex prevents genome instability, as determined by the accumulation of gamma-H2AX and 53BP1 foci and single-cell electrophoresis in cells depleted of the TREX-2 subunits PCID2, GANP and DSS1
24894343 TNBC is a strong predictor for the presence of a BRCA1 mutation in this population, but additional risk factors should also be evaluated to ascertain a 10 % or higher prior probability of BRCA1/2 mutation testing.
24890143 results of this study suggest that homozygosity for the BRCA2 T(-1144) allele is associated with a longer disease-free interval in Chinese women with breast cancer
24884828 Findings contribute significantly to the types of germline BRCA1/BRCA2 mutations and their biological effects in Turkish women.
24880342 BRCA2 p.Lys3326X is associated with lung cancer.
24853100 Data indicate that BRCA mutation status did not influence the generational difference in age at diagnosis .
24835992 BRCA2 facilitates Rad51 phosphorylation by Plk1, which promotes genome stability.
24814045 this work gives the first evidence of a BRCA2 germline pathogenic mutation associated with CRC risk.
24775809 The negative interplay between Aur A/B and BRCA1/2 inversely controls the cell proliferation, cell cycle progression, cell multinuclearity, and tetraploidization to modulate tumorigenesis.
24771600 A model designed to yield optimal intervention strategies including prophylactic surgeries and breast screening for BRCA1/2 mutations carriers is presented.
24728577 The BRCA2 p.Asn3124Ile (BRCA2 c.9371A > T) variant is a rare mutation with a damaging effect on the BRCA2 protein that is strongly associated with familial breast and ovarian cancer risk, indicating its likely pathogenic nature and clinical relevance.
24728189 Mutations were most frequent in BRCA1 and BRCA2, with 84 EOC cases (3.8%) carrying a BRCA1 mutation and 94 epithelial ovarian cancer cases (4.2%) carrying a BRCA2 mutation.
24700448 BRCA2 mutation is associated with breast and ovarian cancer.
24698998 May be associated with cancer risk in BRCA1/2 mutation carriers.
24686251 By sequencing, one BRCA2 LGR, the Portuguese founder mutation c.156_157insAluYa5.
24675954 this study argues that tumor suppression by BRCA1 and BRCA2 originates from their fundamental role in controlling the assembly and activity of macromolecular complexes that monitor chromosome duplication, maintenance, and segregation across the cell cycle.
24672057 depletion of genes within the ataxia telangiectasia and Rad3 related (ATR) and BRCA1/BRCA2 pathways, chromatin modification, and transcription-coupled repair reduced the synergy between mitomycin C and MLN4924
24627042 knockdown of BRCA2 using small interference RNA suppression increased the sensitivity to 5-FU of human oral cancer cell lines
24607278 This work highlights the contribution of DNA, RNA, and in silico data to assess the pathogenicity of BRCA1/2 variants of uncertain significance, which, in turn, allows more accurate genetic counseling and clinical management of the families carrying them.
24598993 The article summarizes the multiple functions for BRCA2 in the preservation of chromosome stability which explain its tumour suppressive function. [review]
24577588 Metastatic high-grade serous carcinomas with BRCA1 deficiency exhibit characteristic morphological features that appear more sensitive and specific for BRCA1 and BRCA2 mutations than two other morphologically based prediction systems
24567435 Preventive oophorectomy was associated with an 80% reduction in the risk of ovarian, fallopian tube, or peritoneal cancer in BRCA1 or BRCA2 carriers and a 77% reduction in all-cause mortality.
24566764 In conclusion, our result shows that large genomic rearrangement in the BRCA1 and BRCA2 genes account for a very low proportion of BRCA mutations and does not seem like a major determinant of breast cancer susceptibility in Korean, breast cancer patients.
24529552 BRCA1/2 mutation carriers are potentially at higher risk of cardiovascular diseases due to early surgical menopause, and cardiotoxic effects of adjuvant treatment for breast cancer.
24519767 women who are positive for BRCA mutations and who are treated for stage I or II breast cancer with bilateral mastectomy are less likely to die from breast cancer than women who are treated with unilateral mastectomy.
24518526 BRCA mutations in prostate cancer patients.[review]
24489791 This study used multifactorial likelihood analysis and/or bioinformatically-directed mRNA assays to assess pathogenicity of 19 BRCA1 or BRCA2 variants.
24489760 There was no evidence for association between developing breast/ prostate cancer or being a BRCA1 or BRCA2 mutation carrier and telomere length.
24485656 PALB2 and BRCA2, in addition to their functions in D loop formation, play crucial roles in the initiation of recombination-associated DNA synthesis by Poleta-mediated DNA repair.
24479546 This finding indicates involvement of hereditary factors in non-BRCA1/2 breast cancer families.
24477976 poor prognosis of young BRCA1/2 mutation carriers with breast cancer is mainly explained by the prevalent occurrence of negative prognostic factors rather than mutation status
24473064 PCAT-1 expression produces a functional deficiency in homologous recombination through its repression of the BRCA2 tumor suppressor.
24472143 our study did not find association between the three most common BRCA1 & BRCA2 mutations and endometriosis
24448978 BRCA2 mutation is asssociated with low response to chemotherapy in breast cancer.
24442642 We demonstrate that circulating PE and EM are strongly and positively correlated with tissue-specific PE and EM measured in NAF and DLS among postmenopausal BRCA1/2 mutation carriers
24395671 Report show a Fanconi anemia family with a novel mutation in the splice donor site of intron 1 of BRCA2 leading to reduced expression of a transcript that lacks part of the 5'-UTR.
24384087 BRCA2 is cleaved into two fragments by membrane type-1 matrix metalloproteinase (MT1-MMP), and knockdown of MT1-MMP prevents the removal of BRCA2 from centrosomes during metaphase.
24378620 This pilot study evaluates the relation between carrying a BRCA1/2 mutation and fertility, using the level of anti-mullerian hormone (AMH), which has been previously shown to be an accurate marker of ovarian reserve and fertility potential.
24372583 Twelve pathogenic mutations were detected (25%); three in BRCA1 (c.211dupA in four families, c.5266dupC in three families and c.1504_1508delTTAAA in one family) and two novel mutations in BRCA2 (c.1313dupT in two families and c.7654dupT in two families).
24348212 Studies may implicate the BRCA2 pathway in tumorigeneis.
24337145 variations of the BRCA2may contribute to breast cancer susceptibility along with variations in other low penetrating genes in sporadic types of breast cancer in this cohort of the population
24312913 the global spectrum of BRCA2 mutations in breast cancer (Review)
24306927 Studies suggest that in the majority of cases with BRCA1 and BRCA2 negative familial breast cancer the etiology is due to interactions of intermediate or low risk alleles with environmental and lifestyle factors.
24302565 Two cancer syndrome gene variants likely to affect native translation initiation were identified by clinical genetic testing: MLH1:c.1A>G p.(Met1?) and BRCA2:c.67+3A>G.
24301060 CRCs may be part of the tumour spectrum associated with FANCD1/BRCA2 biallelic mutations and that the presence of such mutations should be considered in families with CRCs, even in the absence of cardinal features of FA.
24292448 The SIR for BRCA2 carriers was 0.82.
24289560 Neither BRCA1 nor the BRCA2 studied variant show any significant association with the disease.
24289229 The imbalance of DSS1 over-expression associated with BRCA2 expression could affect breast cancer development.
24285858 BRCA1 mutation carriers conferred lower overall breast and ovarian cancer risks than reported so far, while the estimates of BRCA2 mutations were among the lowest in a Dutch cohort.
24285840 Noncarriers remain at risk in the prospective follow-up of women who tested negative for BRCA1/2.
24285729 both BRCA1 and PALB2 are required for BRCA2-focus formation when the DBD is absent.
24281364 No association between FMR1 low genotypes and BRCA1/2 mutations in a cohort of 125 Ashkenazi women.
24268522 the models reveal novel aspects of cancer evolution in carriers of germline BRCA2 mutations, provide new insights into the tumour suppressive role of BRCA2
24265793 the total mutation burden coupled with BRCA1 or BRCA2 mutations in ovarian cancer is a genomic marker of prognosis and predictor of treatment response.
24259538 For some populations, the number of Fanconi anaemia-patients with biallelic BRCA2 disruption is smaller than that expected from the carrier frequency. [Review]
24244370 LUDLU-1 contains somatic mutations in TP53 and BRCA2, allelic imbalance in the expression of two cancer-associated BRCA1 germline polymorphisms and reduced transcription of a potentially endogenous PARP2 inhibitor.
24217135 BRCA1/2 mutation carriers seemed to be more at risk of neutropenia after the first cycle of the treatment in early breast cancer patients
24171172 new insights into the mechanisms underlying genetic instability mediated by hypoxia and BRCA involvement in sporadic breast cancers.
24162189 BRCA2 accumulates DNA damage, which triggers checkpoint signalling and ARF activation
24156927 Female brca2 mutation carriers born in 1958 or later were at a significantly higher risk of developing breast cancer at a younger age (p<0.001), while no such age cohort-dependent correlation was found for ovarian cancer.
24153343 genetic associations studies in populations of women in South Korea: Data suggests that consumption of soy foods is associated with lower breast cancer risk and this lower risk of breast cancer extends to subjects with BRCA1 and BRCA2 mutations.
24145998 these data support the hypothesis that the presence of BRCA mutations does not alter the clinical outcome for hereditary breast cancer patients.
24145348 Studies suggest that associations between ever use of oral contraceptive (OC) and ovarian and breast cancer among women who are BRCA1 or BRCA2 mutation carriers are similar to those reported for the general population.
24141787 three different cancer susceptibility and FA proteins function in a DNA repair pathway based upon the PALB2 WD40 domain binding to RAD51C and BRCA2.
24140203 Carriers of BRCA1/BRCA2 mutations are exposed to higher titres of oestradiol and progesterone-known risk-factors for breast cancer.
24136669 Pregnancy concurrent with or after a diagnosis of breast cancer does not appear to adversely affect survival among BRCA1/2 mutation carriers.
24131973 Our data demonstrate a wide variety of BRCA mutations in a highly ethnically diverse EOC population, and confirm that EOC BRCA mutation carriers have better prognosis with longer median survival than patients with nonhereditary disease.
24131965 As 60%-80% of all advanced ovarian cancers are high-grade serous type, exhibiting HRD in at least 50% (BRCA1/2 mutations ) future antitumor strategies may depend on identifying these defects through molecular testing
24081944 found no evidence that BRCA1 and BRCA2 mutation carriers are at higher risk of natural menopause at a given age than their noncarrier relatives
24081797 BRCA2 mutation is associated with response to chemotherapy in ovarian cancer.
24065545 The first comprehensive analysis of large mutations in BRCA1 and BRCA2 genes in Poland, is reported.
24065114 The distribution of FMR1 CGG repeat numbers in BRCA mutation carriers and non-carriers is similar in contrast to previous reports.
24013206 findings suggest a mechanism for the regulation of the nucleocytoplasmic distribution of BRCA2 and RAD51 and its impairment by a heterozygous disease-associated mutation
23982256 BRCA2 mutation is associated with breast cancer.
23975317 BRCA2 mutation is associated with triple-negative breast cancer.
23975082 The risk of finding a BRCA1/2 mutation in women 40 years or younger is comparable to women of all ages with epithelial ovarian cancer.
23971979 PIK3CA mutations are frequently observed in BRCAX but not BRCA2-associated male breast cancer.
23957571 Our results indicate that carriers of BRCA1/2 mutations among non-Caucasian breast cancer patients showed no enhancement in radiation sensitivity.
23941904 BRCA2 mutations confer a survival advantage compared with the BRCA1 mutation in BRCA-mutated epithelial ovarian cancer patients.
23935836 The goal of this study was to determine the prevalence of PALB2 mutations in a population of BRCA1/BRCA2 negative breast cancer patients selected from either a personal or family history of pancreatic cancer.
23929434 BRCA2 mutation is associated with breast cancer.
23928241 This article reviews current recommendations and limitations of using MR imaging of the breast to screen asymptomatic women at high risk for breast cancer. [review]
23918944 provides evidence that tamoxifen use is associated with a reduction in contralateral breast cancer risk for BRCA1 and BRCA2 mutation carriers
23881989 there is emerging evidence of relative resistance of tumors containing BRCA1 or BRCA2 mutations (or BRCAness) to taxanes.
23877192 Germline mutations in two major genes, BRCA1 and BRCA2, may have an important influence on the predisposition and development of familial breast cancer.
23867999 Deleterious BRCA2 mutation in women with ovarian cancer was an independent risk factor for carboplatin hypersensitivity reactions.
23857704 Breast cancer patients who carry the Icelandic founder BRCA2 mutation have inferior long-term survival than noncarriers, but the adverse prognosis is restricted to mutation carriers with diploid
23846919 Studies indicate that germline mutations in BRCA1/2 and related genes, such as PALB2, are associated with pancreatic cancer.
23810788 BRCA2 mutation is associated with response to therapy in sporadic cancer.
23767878 Four BRCA2 mutations including three novel BRCA2 frameshift mutations and one previously known BRCA2 frameshift mutation and one BRCA1 splicing mutation were identified in a group of consecutive breast cancer patients.
23754601 simplified BRCA2 classifier based on the co-occurrence of Loss of heterozygosity at 13q13 and 14q32 could provide an indication to test for BRCA2 mutation in patients with ER-positive invasive ductal carcinomas.
23747895 BRCA2 homeostasis in prostate cancer cells has been found to be critical in determining cell fates during prostate cancer progression
23711090 Association between BRCA2 mutation and SULT1A1 gene deletion in male breast cancer emerged.
23706288 Findings suggest treatment decisions and the clinical management for patients harbouring deleterious BRCA1/BRCA2 mutations.
23704984 Breast tumors from BRCA1 and BRCA2 mutation carriers display characteristic RNA expression patterns.
23704879 Rare variants of uncertain significance affecting phosphorylation may be a novel and important mechanism for which BRCA1 and BRCA2 functions are disrupted in breast cancer.
23697973 A new common BRCA2 pathogenic mutation c.7235_7236insG was detected in Algerian and Moroccan families. [review]
23683081 We detected 28 distinct pathogenic mutations (16 in BRCA1 and 12 in BRCA2), of which 3 mutations in BRCA1 and 5 in BRCA2 had not been previously described.
23678008 p53 suppresses BRCA2-stimulated ATPase and strand exchange functions of human RAD51 to control homologous recombination.
23658460 We show a high prevalence of BRCA1/2 mutations with LOH in an Ashkenazi Jewish cohort of surgically resected PDAC and neoplastic lesions, suggesting that these germline mutations are causal in selected individuals.
23635950 Aim of this study was to determine types and frequencies of BRCA mutations in individuals from high-risk families from Serbia.
23615136 All patients with BRCA1 and BRCA2 risk factors need large genomic rearrangement screening for breast cancer.
23585894 Heterogeneous nuclear ribonucleoprotein C is a key regulator of BRCA gene expression and homologous recombination-based DNA repair.
23569316 BRCA1/2 germ-line mutations confer a more aggressive prostate cancer phenotype with a higher probability of nodal involvement, distant metastasis and poor survival.
23567481 Tumor size estimation using breast MRI in high risk patients is comparable to its performance in sporadic cancers.
23562522 The SIR for BRCA1 carriers was 1.91 (95% CI: 1.06-3.19, p=0.03) and for BRCA2 carriers was 1.75 (95% CI: 0.55-4.23, p=0.2).
23548269 Data indicate that interruption of ATR signaling strikingly further sensitized BRCA1- and BRCA2-deficient ovarian cancer cells to PARP inhibition.
23544012 This comprehensive update of novel and previously reported breast cancer susceptibility loci contributes to the establishment of a panel of SNPs that modify breast cancer risk in BRCA2 mutation carriers
23531862 6 (BRCA1) and 8 (BRCA2) microsatellite markers in a multiplex PCR.
23528734 Our data confirm the previously reported highly skewed distribution of FMR1 genotypes and sub-genotypes toward a high preponderance of low FMR1 alleles in BRCA1/2 carriers.
23504064 BRCA2 gene mutation is associated with breast and ovarian cancers.
23490645 Results show that age of onset in carriers of BRCA mutations is earlier than expected. Especially for BRCA1
23483928 Genotypes of AIB1 polyglutamine polymorphism analyzed do not appear to be associated to a modified risk of breast cancer development in BRCA1 and BRCA2 mutation carriers.
23479189 Recurrent BRCA2 gene mutation is associated with breast and ovarian cancers.
23469205 Germline BRCA1 and BRCA2 mutations were detected in 13% and 7% of the early-onset breast cancer Brazilian patients.
23458327 The study identified one of seven founder mutations in BRCA1 and BRCA2 in 27% of breast cancer patients in the Bahamas.
23451180 Eleven variants in BRCA1 and 8 in BRCA2, including 8 not previously characterized at transcript level, were ascertained to affect mRNA splicing
23420552 present the proof of principle of a NGS-based mutation screening procedure allowing the detection of inherited Alu insertions within any predefined sequence by investigating 2 cases: c.1739_1740insAlu in BRCA1 and c.156_157insAlu in BRCA2
23417715 BRCA2 germline mutation carrier has Ampulla of vater adenocarcinoma.
23415752 This study characterises the mutation, expression and methylation status of BRCA1/2 in 41 ovarian cancer cell lines.
23414920 Mean age at natural menopause is 48.8 years for BRCA1 carriers, 49.2 years for BRCA2 carriers, and 50.3 years for control subjects.
23411475 The idea that BRCA1/2 mutations have antagonistic pleiotropic effects (enhancing fertility while reducing survival) was supported in the natural fertility study.
23409121 BRCA1 and BRCA2 germline mutation-related DCIS show a high frequency of overexpression of HIF-1alpha.
23409019 findings support the hypothesis that the majority of non-BRCA1/BRCA2 breast cancer families might be explained by the action of moderate and/or low penetrance susceptibility alleles
23370825 data indicate that BRCA1 carriers diagnosed with MBC have worse outcomes compared to BRCA2 carriers and non-carriers. However, the differences in outcome did not reach statistical significance likely due to small sample sizes
23364291 review summarizes the recent findings on the epidemiology of BRCA1/2 mutations among ovarian carcinoma patients in various geographical areas with special reference to racial/ethnic groups and the common founder mutations
23326384 Data indicate an increase of VEGF, HIF-1alpha expression and microvessel density (MVD) in BRCA1-2 carriers and BRCAX compared to the sporadic control group.
23320992 in a sample of Black women with early onset breast cancer, study evaluated BRCA mutations; BRCA mutation prevalence and the high prevalence of variants of uncertain significance in participants are consistent with prior studies
23319376 the imbalance in expression of Aurora-A and BRCA2 regulates RAS-induced genomic instability and tumorigenesis
23299404 Two new susceptibility loci. rs11571836 located in the BRCA2 3'-untranslated region.
23284877 Deletion of chromosomes 13q and 14q is a common feature of tumors with BRCA2 mutations.
23271408 Results suggest that increased production of E(2) may have a role in the pathogenesis of BRCA2-mutation-related breast cancer.
23265709 Data indicate that younger patients with BRCA1 and BRCA2 (BRCA1/2)-mutated ovarian cancers (BMOC) (<53 years) appeared to have a poorer progression-free-survival compared with patients with BMOC who were older at the point of commencing paclitaxel.
23262210 Older age, absence of a strong family history, and poor survival are all associated with decreased clinical identification of inherited BRCA1/2 mutations in women with ovarian cancer.
23257159 for women with invasive ovarian cancer, the short-term survival advantage of carrying a BRCA1 or BRCA2 mutation does not lead to a long-term survival benefit
23249957 Results indicate that this workflow performed analysis of BRCA1 and BRCA2 genes point mutations with a specificity of 100% and a sensitivity >/=97.5%.
23233716 in a study of US Hispanics, deleterious BRCA mutations were detected in 189 of 746 clinic patients(124 BRCA1, 65 BRCA2); a significant proportion were large rearrangement mutations
23232696 Data indicate that the median levels of Ang-1, Ang-2 and VEGF mRNA were significantly higher in patients harboring BRCA1/2 germline mutations.
23231788 Classified 88 missense VUS in BRCA1 and BRCA2 on the basis of an in silico analysis and compared the classification of a subset of 60 VUS of which additional information including family, genetic and tumour data was available.
23184082 Combined SEER database and retrospective study data analysis of lifetime risk of developing ductal carcinoma in situ and BRCA1 and BRCA2 carrier status.
23165508 PARP inhibitor resistance correlated with the emergence of a secondary BRCA2 mutation in patients following an initial favorable response.
23149936 Human Rad51 paralogs facilitate BRCA2-Rad51-dependent homologous recombination at different stages in the pathway and function independently of Rad52.
23146957 Our findings do not support the usefulness of X chromosome inactivation analysis for the identification of BRCA mutation carriers and cancer risk assessment.
23146383 BRCA2 mutation status did not appear to correlate with a distinct clinicopathological phenotype or disease behaviour, and a strong trend was seen suggesting a possible BRCA2 male breast cancer phenotype.
23110154 Data show a substantial proportion of germ-line mutations in triple-negative breast cancer (TNBC), with a preponderance of BRCA1 mutations over mutations in BRCA2 or PALB2, but no evidence to implicate BRD7 mutations in the etiology of TNBC.
23096105 found BRCA1/2 mutations in 15/103 probands. Among these, a BRCA2 gene mutation has not been described previously. In addition, we identified five novel BRCA2 variants
23082475 Sixty-two patients (index cases) with invasive breast cancer belonging to sixty families and their asymptomatic female first-degree relatives (300 cases) were studied for germline mutations of BRCA1 and BRCA2 genes.
23071527 Two BRC3 mutations (K1440R and K1440E), reported in human breast cancer patients, occur at amino acids corresponding to those of the K1435R mutation in dogs. These mutations affected the interaction of canine BRC3 with RAD51
23066998 The parental mutation origin did not affect the risk in women with a BRCA2 mutation.
23057551 review of progress in understanding of BRCA1 and BRCA2 mutations in ovarian cancers and how these findings affect therapeutics; differing prognostic effects of BRCA2 and BRCA1 mutations is likely due to differing roles of BRCA1 and BRCA2 in homologous recombination repair and stronger association between the BRCA2 mutation and hypermutator phenotype
23050611 In BRCA2 mutation carriers there was significant association between overall breast cancer risk SNP score and age at breast cancer onset.
23035815 HGPIN is considered a precursor to cancer, as no LOH was observed, this assay does not provide a genetic marker that may be considered a positive predictor of tumorigenesis in BRCA2 carriers.
23011509 This follow-up study suggests that, contrary to our initial report, this variant is not associated with breast cancer risk among individuals with germline BRCA2 mutations.
22984553 BRCA1/2 mutations appear embryo-lethal unless rescued by low (CGG n<26) FMR1 sub-genotypes
22972572 Evidence based on spontaneous chromosome abnormalities and epidemiologic data indicates strong effects from exogenous mutagens and does not support the inevitability of cancer in all BRCA1/2 mutation carriers.
22970155 BRCA mutations account for a substantial proportion of hereditary breast/ovarian cancer in Southern Chinese population.
22967960 BRCA1/2 mutation carriers exhibited no significant increase in proliferation in the fallopian tube epithelial cells either in the ampulla or fimbriated ends of the tube.
22962691 BRCA2 exon 7 splicing is regulated by multiple exonic elements and is sensitive to disease-associated sequence variations.
22923021 Novel BRCA1 and BRCA2 pathogenic mutations in Slovene hereditary breast and ovarian cancer families.
22915752 In TNBC cells that PI3K inhibition leads to DNA damage, downregulation of BRCA1/2, gain in poly-ADP-ribosylation, and subsequent sensitization to PARP inhibition.
22901131 Methylation types of the BRCA2 promoter in different genotypes of the MTHFRa1298c polymorphism is not associated with ovarian cancer
22895246 Association of a BRCA2 mutation with inflammatory breast cancer with two members of the same family.
22829013 High frequency of BRCA2 founder mutations are associated with gastrointestinal and tongue neoplasias in breast cancer.
22809218 Although there was an association between two SNPs in BRCA2 and cardiovascular disease in a multi-ethnic population, these results were not replicated in two South Asian case-control studies of incident myocardial infarction.
22798144 characteristics of BRCA1/2 germline mutations in Korean patients with breast and ovarian cancer; 420 (150 distinct) pathogenic mutations were identified, 211(73 distinct)in BRCA1 and 209 (77 distinct)in BRCA2; majority of distinct mutations resulted in premature termination codon of the BRCA1/2 translation
22789542 show a repair-independent requirement for FA genes, including FANCD2, and BRCA1 in protecting stalled replication forks from degradation
22788243 Low doses of mammography X-rays have the potential to induce chromosomal instability in fibroblasts from BRCA mutation carriers.
22771033 A specific role for BRCA2 in the regulation of midbody structure and function is identified that is separate from DNA damage repair and is an explanation of whole-chromosomal instability in BRCA2-deficient tumors.
22768030 A locus on chromosome 6q22.33 (rs2180341) was evaluated to see if it modifies breast cancer risk in 3,361 BRCA1 and 2,020 BRCA2 carriers.
22753899 Case Report: Ovarian cancer with metastasis to the brain in patient with BRCA2 mutation.
22753590 Identification of a new mutation located deep into intron 12, c.6937+594T > G, which systematically activates splicing of a cryptic exon introducing a premature termination codon in the coding sequence.
22752604 study examined BRCA1/BRCA2 gene mutations/SNPs and BRCA1 haplotypes in early-onset breast cancer patients of Indian ethnicity; findings indicate a high incidence of BRCA1/BRCA2 gene mutations in the Indian patients
22744338 studies suggest substantial mortality benefits in using MRI to screen BRCA1/2 mutation carriers aged 25 to 60 years
22739995 study genotyped recurrent BRCA1/BRCA2 mutations among Nigerian, African American, and Barbadian breast cancer patients
22736296 BRCA2 mutation is associated with breast and ovarian cancer.
22734169 Among the 1017 women referred for BRCA testing, 63 women younger than 52 years of age who had been diagnosed with breast cancer were found, subsequent to this diagnosis, to have BRCA1 or BRCA2 gene mutations.
22729394 IRS1 Gly972Arg single-nucleotide polymorphism, which affects insulin-like growth factor and insulin signaling, modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers and breast cancer risk in BRCA1 class II mutation carriers.
22710074 Invasive tubal carcinoma and TIC were limited to BRCA-mutation carriers, whereas hyperplasia and minor epithelial atypia were commonly found in both BRCA-mutation carriers and controls.
22684231 8 new missense unclassified variants were identified in the BRCA1 and BRCA2 genes in Algerian breast/ovarian cancer families.
22682623 The first report identifying BRCA2 mutations in Puerto Rico.
22680617 Data suggest that if survival rates are based on tested patients, all of whom are alive at the time of testing, then the survival experience will be overestimated, both for women who test positive for BRCA1 or BRCA2 mutations and for non-carriers.
22678057 Functional characterization of 12 cancer associated BRCA2 mutations.
22673632 Article presents a comprehensive review of the relevant literature on the role of BRCAness in ovarian cancer with respect to BRCA function.
22666503 BRCA2 mutation frequency in triple-negative breast cancer
22655046 In patients diagnosed with breast and ovarian cancer the study found 4 novel deleterious mutations (c.2805_2808delAGAT and c.3124_3133delAGCAATATTA in BRCA1; c.2639_2640delTG and c.5114_5117delTAAA in BRCA2).
22652532 It is concluded that a proportion of patients with therapy related myeloid neoplasms carry cancer susceptibility mutations,including BRCA2 mutations, which is likely to contribute to therapy related leukaemogenesis.
22645136 Data indicate taht BRC repeat is a common RAD51 recombinase interaction module that can either promote homologous recombination (HR), as in the case of BRCA2, or to suppress HR, as in RECQL5 helicase.
22632462 investigation of the effect on splicing of BRCA2 variants c.8488-1G > A (exon 20) and c.9026_9030del (exon 23), and 41 BRCA2 variants reported in the Breast Cancer Information Core mutation database; a relevant proportion of BRCA2 variants are correlated with splicing disruptions
22614657 in patients with triple-negative breast cancer, BRCA1 mutation prevalence was lower, and BRCA2 mutation prevalence was higher, than previously described
22586318 PARP inhibitors may represent a new and promising targeted therapy for patients with BRCA1/2 -associated cancer.
22579790 For breast cancer, BRCA mutation status is not associated with the rate of optimal tumor debulking at primary surgery after accounting for differences in patient age.
22579622 high levels of BRCA2 perturb Rad51-mediated homologous recombination
22569005 The aim is to determine whether DNA-direct is an acceptable procedure for BRCA1/2 testing, in order to provide customized care to patients with breast cancer
22535016 Caucasian female with double heterozygosity for disease-causing BRCA1 and BRCA2 mutations carriers seem to develop breast cancer at a younger age and have a more severe disease than carriers of a single BRCA mutation.
22513257 three cis-acting BRCA2 polymorphisms that alter the binding of transcription factors at regulatory sites and could possibly affect the risk in mutation carriers through altering expression levels of the wild-type allele
22476849 No new rearrangements were found in the BRCA2 gene in 472 patients with breast cancer predisposition.
22447567 findings not only show that Mre11 activity is required for the survival of BRCA2 mutant cells but also elucidate roles for both the BRCA2 and PARP1 proteins in protecting stalled replication forks
22443199 Several common alleles have been found to modify breast or ovarian cancer risk for BRCA1 and BRCA2 mutation carriers. These common alleles explain a small proportion of the genetic variability in breast or ovarian cancer risk for mutation carriers.
22434521 Four novel structural alterations at the BRCA2 locus in hereditary breast and ovarian cancer syndrome families.
22430443 Single nucleotide polymorphisms in BRCA2 gene modify the association between occupational exposure to solvents and is associated with non-Hodgkin's lymphoma.
22430266 Breast and ovarian cancer risk are high in women with BRCA2 genetic mutation.
22429596 Age and grade differed significantly between BRCA1 and BRCA2 carriers in our study population.
22425665 Data suggest that BRCA1 and BRCA2 mutations are responsible for a significant proportion of familial breast cancer in Moroccan patients.
22425664 PWC has the potential to detect occult peritoneal carcinoma in patients with BRCA1 or BRCA2 mutations.
22406760 BRCA1 and BRCA2 mutations occurred more frequently in platinum-sensitive EOC than platinum-resistant disease.
22401979 The penetrance of the mutation and the aggressiveness of the related tumor could depend on a dosage effect of the mutated allele transcript.
22399190 The rate of some seemingly recurring germline mutations in the BRCA2 gene in breast/ovarian high risk Israeli women of diverse ethnic origin were determined.
22382806 BRCA2 mutations for non-familial Korean breast cancer patients were detected at a high rate, particularly, in patients with early onset of less than 35 years of age, bilateral breast cancer, and breast and ovarian cancer.
22366370 New pathogenic mutation in BRCA2 gene identified in women in Croatia.
22344029 Data show that RBMX accumulated at DNA lesions through multiple domains in a poly(ADP-ribose) polymerase 1-dependent manner and promoted HR by facilitating proper BRCA2 expression.
22339411 Treatment with 18.5 muM Genistein or 78.5 muM Daidzein might reverse DNA hypermethylation and restore the expression of the oncosuppressor genes BRCA1 and BRCA2.
22293751 Here, the authors use proteomic profiling to identify APRIN (PDS5B), a cohesion-associated protein, as a BRCA2-associated protein.
22282309 BRCA1 and BRCA2 mutations correlate with TP53 abnormalities and presence of immune cell infiltrates in ovarian high-grade serous carcinoma.
22274685 Among patients with invasive epithelial ovarian cancer, having a germline mutation in BRCA1 or BRCA2 was associated with improved 5-year overall survival. BRCA2 carriers had the best prognosis.
22262156 The results from this study suggest that height, weight, or weight gain do not influence the risk of ovarian cancer among carriers of a BRCA1 or BRCA2 mutation.
22253870 The expression of DNA repair proteins, including PARP, FANCD2, BRCA1, PTEN, H2AX, ATM, as well as p53, was studied to see if it correlated with response to treatment, recurrence rate, and survival in ovarian cancer.
22252577 Studies across multiple ethnicities demonstrate that BRCA1 and BRCA2 mutations not only increase the risk of prostate cancer, but also predispose patients to early onset of potentially lethal disease. (Review)
22252303 Overweight BRCA mutation carrier women seem to be at risk of developing more cortical invaginations than women of normal weight.
22228431 the in frame BRCA2 deletion c.9203_9328del126 is a rare mutation strongly associated with familial breast cancer.
22212556 functional KL gene variants had no discernable effect on either breast or ovarian cancer risk in a large group of ethnically diverse BRCA1 and BRCA2 mutation carriers.
22194698 Our results reveal functional redundancy within the BRCA2 protein and emphasize the plasticity of this large protein built for optimal homologous recombination function in mammalian cells
22193042 Indicate potential strong associations between morphology and BRCA1/2 genotype in high-grade serous carcinomas.
22187435 BRCA2 is required for telomere homeostasis and may be particularly important for the replication of G-rich telomeric lagging strands.
22179631 Loss of heterozygosity at BRCA2 locus had no associations with estrogen receptor or progesterone receptor status and prognosis.
22158906 C-myc up-regulated miR-1245 expression which led to down-regulation of BRCA2.
22144499 Pathologic characteristics of BRCA1 and BRCA2 tumors may be useful for improving risk-prediction algorithms and informing clinical strategies for screening and prophylaxis.
22143498 Promoter hypermethylation patterns of of BRCA2 germ line mutation carriers are associated with fallopian tube neoplasms.
22142662 There was no observed difference in the proportion of male breast cancer tumors with abnormal BRCA2 protein expression in Egypt compared to Morocco.
22133571 Tetraploidy was significantly 3 times more common in BRCA2 breast cancers than sporadic but no differences were found in the overall ploidy distribution between BRCA2-mutation carriers and non-carriers.
22126563 The germline mutation frequency of BRCA2 in esophageal squamous cell carcinoma patients from a low-risk Chinese population was significantly higher than that in healthy controls.
22113258 The rate of phenocopy breast cancer in non-carriers from Israeli BRCA1 BRCA2 mutation carrier families is 2.26% with no increased breast cancer risk over the average-risk population.
22072393 report of four interactions between mutations in the breast cancer susceptibility genes ATM and CHEK2 with BRCA1 and BRCA2
22053997 The associations of the 12 SNPs with risk for BRCA1 and BRCA2 carriers differ by ER-positive or ER-negative breast cancer status.
22044689 Fifteen mutations were identified (two in BRCA2 and thirteen in BRCA1) representing 15.6% of the total (95% CI: 7.8% to 21.3%).
22034289 BRCA2 mutations are associated with unselected Nigerian breast cancer patients.
22019625 BRCA2 has an important role in telomere stabilization and protection.
22009639 Women who had ductal carcinoma in situ and a family history of ovarian cancer or who had BRCAPRO scores >/=10% had a high rate of BRCA positivity regardless of age at diagnosis.
21993507 women who are carriers of BRCA1/2 mutations living in natural fertility conditions have excess fertility as well as excess post-reproductive mortality in relation to controls
21990299 among women with high-grade serous ovarian cancer, BRCA2 mutation, but not BRCA1 deficiency, was associated with improved survival, improved chemotherapy response, and genome instability compared with BRCA wild-type
21989927 Germline mutations in the BRCA2 gene is associated with pancreatic cancer.
21987080 We found that haplotypes in APEX1, BRCA2, ERCC2, and RAD51 were significantly associated with total childhood acute lymphoblastic leukemia
21984204 This study suggests that prior appendectomy is more frequently noted in BRCA2 carriers with breast and ovarian cancer than in unaffected mutation carriers.
21978880 Our results suggest an important role of BRCA1 and BRCA2 promoter methylation in breast cancer development in the Tunisian population.
21974800 polymorphisms in BRCA2 do not contribute to cancer risk in a population of Lynch syndrome patients with colorectal cancer
21958427 the deletion of the wild-type BRCA2 allele, together with co-occurring changes at 6 q, 11 q, and 17 q, are important events in progression toward advanced breast cancer.
21952622 results suggest that routine testing of early onset PrCa cases for germline BRCA2 mutations will further help to refine the prevalence and risk associated with BRCA2 mutations and may be useful for guiding management options
21945552 Women with BRCA-associated ovarian tumors demonstrate a greater sensitivity to cytotoxic therapy with Doxil.
21939546 first large rearrangement of the BRCA2 gene that includes all of exon 3 and leads to an in frame deletion of exon 3 at the transcriptional level
21934105 Fifteen patients, five male, with a BRCA1 or BRCA2 mutation and PAC and one patient with a BRCA1 mutation and acinar cell carcinoma of the pancreas were identified.
21918854 Germline mutations in the BRCA2 gene is associated with Iranian breast cancer patients.
21918853 Mutations in the BRCA2 gene is associated low with sporadic breast cancer of Spanish population.
21898151 Mutations in the BRCA2 gene is associated with osteopenia and osteoporosis after risk-reducing salpingo-oophorectomy in breast cancer patients.
21798026 TAS106 induces the down-regulation of BRCA2 and the subsequent abrogation of the homologous recombination pathway, leading to a radiosensitizing effect.
21789034 Findings reveal how sequence variation in the BRC repeats directly affects affinity with RAD51 and provide significant new insights into the control of RAD51 by human BRCA2.
21769658 Abnormal splicing patterns expected to lead to non-functional proteins were observed for 7 BRCA1 and BRCA2 variants in a cohort of patient screening for hereditary breast and ovarian cancer.
21761160 Our results confirm the existence of a central low BC risk region in BRCA1 (LR1) and one in BRCA2 (LR2).
21750719 Data provide insight into the genomic effects of loss of BRCA2 function.
21735045 12 novel BRCA1 and BRCA2 mutations, leading to aberrantly expressed transcripts, were identified in a cohort of hereditary breast and ovarian cancer syndrome patients.
21733824 BRCA2 mutations from multiple breast cancer families are associated with prostate cancer.
21731065 BRCA2 helps restore and maintain integrity of the genome.
21719596 IVS7 + 2T > G produces an alternatively spliced transcript lacking exons 4-7. BRCA2(Delta105) is proficient in homologous recombination-mediated DNA repair. p.L2510P, p.R2336H, & p.W2626C are deleterious. p.I2490T & p.K2729N probably are neutral.
21710692 Promoter hypermethylation of PAX6, BRCA2, PAX5, WT1, CDH13 and MSH6 seems to be a frequent early event in breast cancer
21708937 Associations were found between risk of breast cancer and linkage disequilibrium blocks in IGF2 for BRCA1 and BRCA2 mutation carriers, HTRA1 for BRCA1 carriers, and MMP3 for BRCA2 carriers.
21670699 Risk-reducing salpingo-oophorectomy (RRSO) in BRCA mutation carriers.
21670257 propose that the BRC repeats in BRCA2 cooperate in a partially redundant but reinforcing manner to ensure a high probability of RAD51 filament formation
21665305 the decreased DSB repair capacity of heterozygous BRCA2 mutations suggests gene dosage effects in G2 fibroblasts
21653198 prevalence of BRCA1 mutations in triple negative breast cancer
21649643 evaluation of prevalence of de novo mutations in BRCA1 and BRCA2 in a clinic-based cohort of women seeking risk assessment; results suggest de novo mutations in BRCA1 and BRCA2 are less common than in other hereditary cancer syndromes
21643751 evaluation of frequency and distribution of common BRCA1 and BRCA2 mutations which associated with breast cancer risk (Meta-Analysis)
21637299 BRCA2 and PALB2 are main regulators of G2 checkpoint maintenance following DNA-damage.
21614564 Spectrum and characteristics of BRCA1/2 mutations in Chinese familial breast cancer exhibit some unique features, and Chinese women with familial breast cancer whose tumors are diagnosed at or before the age of 40 are good candidates for BRCA1/2 testing.
21601571 the interaction between BRC repeat 4 (BRC4) and RAD51 was strengthened by the substitution of a single BRC4 amino acid from valine to isoleucine (V1532I).
21598239 BRCA1 and BRCA2 mutations are observed with nearly equal distribution in Ashkenazi Jewish breast-pancreas cancer families, suggesting that both genes are associated with pancreatic cancer risk
21597964 More than 50% of the Ashkenazi Jewish chromosomes with the BRCA1 185delAG mutation share an identical 2.1 Mb haplotype and nearly 16% of Ashkenazi Jewish chromosomes carrying the BRCA2 6174delT mutation share a 1.4 Mb haplotype.
21593217 Single nucleotide polymorphisms in BRCA1 and BRCA2 mutation carriers from 42 studies from the Consortium of Investigators of Modifiers of BRCA1/2, were genotyped.
21591024 A lack of association of the rs2910164:G>C single nucleotide polymorphism with breast cancer risk in a series of 1,166 BRCA1 and 560 BRCA2 mutation carriers, is reported.
21573016 FANCD1/BRCA2 played notably important roles in the repair of TMZ-induced DNA damage.
21565612 BRCA2 prevents rather than repairs nucleolytic lesions at stalled replication forks to maintain genomic integrity and hence likely suppresses tumorigenesis through this replication-specific function.
21557934 The comparison between the two different populations did not show any significant difference regarding BRCA2 methylation but exhibited a trend in the decrease of BRCA2 promoter methylation in peripheral blood DNA of sporadic ovarian cancer.
21555554 Data show that hyperthermia (41-42.5 degrees C) induces degradation of BRCA2 and sensitize innately HR-proficient tumor cells to PARP-1 inhibitors.
21520273 hierarchical statistical modeling of data observed in a case-control study of contralateral breast cancer in which all the participants were genotyped for variants in BRCA1 and BRCA2
21517277 T-C transitions at positions 29 bp and 44 bp in relation to the total sequence of BRCA2 exon 8 were identified.
21514447 Skp2 overexpression reduced BRCA2 protein and promoted cell growth and migration of prostate cancer cells
21499684 Oral contraceptive use and paternal origin of mutation affect breast cancer penetrance in Jewish BRCA1 and BRCA2 mutation carriers.
21487248 Loss of function of various proteins involved in double strand break repair other than BRCA1/2 has been suggested to be synthetically lethal with PARP inhibition.
21476145 BRCA2 N372H polymorphism is associated with follicular lymphoma.
21441901 AURKA expression is an unfavorable prognostic factor in patients with endometrioid ovarian cancer and BRCA2 is favorable.
21427728 An association was observed between p.Arg280His-rs25489 in XRCC1 and breast cancer risk for BRCA2 mutation carriers, with rare homozygotes at increased risk relative to common homozygotes.
21425892 7-fold increase in Endometrial Cancer risk with tamoxifen exposure is asscoiated with female family members from BRCA2 mutation.
21424757 BRCA2 mutation is associated with high risk of pelvic serous cancer.
21409565 EMSY amplification may mimic BRCA2 deficiency, at least by overriding RPA and PALB2, crippling the BRCA2/RAD51 complex at DNA-damage and replication/transcription sites
21399666 a novel function for HMG20b in cytokinesis is regulated by its interaction with the BRC repeats of BRCA2
21394826 This study has assessed the possible pathogenicity of 26 intronic BRCA1 or BRCA2 variants in breast cancer.
21391735 the rate of BRCA1/2 mutations in double primary breast and ovarian cancer (DPBOC) patients is probably less than 60%.
21378390 Case Report: cure following platinum-resistant stage III ovarian carcinoma in a woman with a BRCA2 mutation. The patient was subsequently treated with oral melphalan therapy and has not recurred in over 25 years.
21356067 The BRCA2 gene was screened for mutations in well-characterized, Finnish, high-risk hereditary breast and/or ovarian cancer individuals.
21336636 Studies indicate that most of these breast cancers are caused by mutations in the high penetrance genes BRCA1 and BRCA2 accounting for about 5% of all breast cancers.
21324516 BRCA1 and BRCA2 mutations are common in women with invasive ovarian cancer. All women diagnosed with invasive non-mucinous ovarian cancer should be considered to be candidates for genetic testing.
21318380 40 novel sequence variations in BRCA1 and BRCA2 in high risk breast and/or ovarian cancer familiesin Denmark.
21278312 analysis of early BRCA1 and 2-associated ovarian and fallopian tube tumorigenesis
21276604 This multicenter study demonstrates a significant survival advantage in advanced stage ovarian cancer patients with non-AJ BRCA mutations, confirming the previous studies in the Jewish population.
21232165 Among the mutations detected in the Slovenian population, 5 mutations in BRCA1 and 4 mutations in BRCA2 have not been described in other populations until now.
21222048 Elevated expression of BRCA2 correlates with TGF-beta1 and HER2 in breast cancer and these three factors may act in synergy to promote cancer.
21221768 following a diagnosis of breast cancer, the annual risk of ipsilateral breast cancer risk in BRCA mutation carriers is 1.2% per year.
21206239 BRCA2 germline mutations are associated with uterine serous carcinoma.
21204799 A frequent founder BRCA2 mutation in non-Afrikaner breast cancer patients of the Western Cape of South Africa.
21190077 We identified seven different truncating mutations in seven families, five in BRCA2 three in site-specific breast cancer families and two in breast-ovarian cancer families
21161372 found no significant associations between any single-single-nucleotide polymorphisms or haplotypes of BRCA1 or BRCA2 and risk of contralateral breast cancer among all women
21156238 analysis of germline mutations of BRCA1 and BRCA2 genes in Turkish breast, ovarian, and prostate cancer patients
21149333 BRCA1 mutations are associated with breast carcinoma In Situ.
21148102 Rad52 can respond to DNA double-strand breaks and replication stalling independently of BRCA2
21123638 A review of MEDLINE from 1989 through 2010 for the terms BRCA1, BRCA2, breast cancer, ovarian cancer, risk assessment, and genetic testing is presented.
21119368 This high rate of BRCA germline mutations in uterine serous carcinoma(USC) patients coupled with a high rate of personal and familial cancer histories may suggest that USC is associated with the hereditary breast-ovarian syndrome.
21119070 Higher levels of AI in BRCA1/2 were associated with a 4.22-fold increased risk of familial ovarian cancer.
21118973 study evaluated the associations of SNPs, rs4973768 in SLC4A7/NEK10, rs6504950 in STXBP4/COX11, and rs10941679 at 5p12, and reanalyzed the previous associations using additional carriers in a sample of 12,525 BRCA1 and 7,409 BRCA2 carriers
21084279 results suggested that a complex consisting of BRCA2, NPM, and ROCK2 maintains the numerical integrity of centrosomes and accurate cell division and that dysfunction of this regulation might be involved in the tumorigenesis of breast cancer
21079137 Observational study of gene-disease association. (HuGE Navigator)
21063910 BRCA2 founder mutations are associated with breast cancer and/or ovarian cancer.
21060860 Results indicate that SNPs that modify BRCA2 penetrance identified by an agnostic approach thus far are limited to variants that also modify risk of sporadic BRCA2 wild-type breast cancer.
21060860 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21042765 BRCA1 and BRCA2 genetic test in high risk patients and families.
20978178 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20972632 BRCA2 mutation is associated with breast cancer.
20960228 there are no predominant recurring germline mutations in BRCA1 or BRCA2 genes among ethnically diverse Jewish and non Jewish high risk families in Israel.
20960027 Only tumor cell lines with a combination of high Aurora-A and -B expression, BRCA2 mutation and p53 defects showed more sensitivity towards Aurora inhibition than other cell lines.
20950396 Observational study of gene-disease association. (HuGE Navigator)
20927582 males who develop breast cancer may have mutations in BRCA2, and possibly in PALB2
20927582 Observational study of gene-disease association. (HuGE Navigator)
20924075 18 individuals (1.51%) who concomitantly carried the 185delAG BRCA1 and the 6174delT BRCA2 mutations and four individuals (0.34%) who carried the 5382insC BRCA1 and the 6174delT mutations
20924075 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20919953 Suggest that the frequency of BRCA1/2 gene rearrangements is very low in Turkish breast/ovarian cancer patients.
20878485 BRCA2 mutations are associated with breast cancer and/or ovarian cancer.
20878484 BRCA2 frame shift mutations are associated with defective protein translocation.
20877358 A new human breast cancer xenograft obtained from a BRCA2-mutated patient.
20872766 findings support PALB2 and BRCA2 as risk genes specifically for bipolar disorder, and suggest that altered DNA repair related to neurogenesis may be involved in BD pathophysiology
20871615 PALB2 can function synergistically with a BRCA2 chimera (termed piccolo, or piBRCA2) to further promote strand invasion.
20859677 Observational study of gene-disease association. (HuGE Navigator)
20850175 Observational study of gene-disease association. (HuGE Navigator)
20842456 Observational study of gene-disease association. (HuGE Navigator)
20840664 Targeted prostate cancer screening in men with mutations in BRCA1 and BRCA2 detects aggressive prostate cancer.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20809358 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
20809262 BRCA2 mutation is associated with basal cell carcinoma.
20809262 Observational study of gene-disease association. (HuGE Navigator)
20807450 A common genetic variant in BRCA2 (1342A > C) occurred less frequently in deleterious mutation carriers of breast cancer.
20804917 Characteristic pathological features and older age of onset among BRCA1-mutated estrogen receptor positive breast cancers.
20798986 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20736950 Multivariate analysis confirmed that the poorer survival of PrCa in BRCA2 mutation carriers is associated with the germline BRCA2 mutation per se
20736950 Observational study of gene-disease association. (HuGE Navigator)
20733129 Testing women with triple negative breast cancers who were younger than 50 years for BRCA mutations is a cost-effective strategy and should be adopted into current guidelines for genetic testing.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20730487 BRCA2 mutation is associated with menopausal status modifying the association between body weight and breast cancer and disease progression.
20729859 Full-length BRCA2 binds to ~6 RAD51 molecules and promotes RAD51 binding to ssDNA coated by replication protein A in a manner that is stimulated by DSS1.
20729858 BRCA2 binds selectively to ssDNA & to ssDNA in tailed duplexes & replication fork structures. directed the binding of RAD51 recombinase to ssDNA, reduced the binding of RAD51 to duplex DNA and stimulated RAD51-mediated DNA strand exchange.
20729832 BRCA2 is a key mediator of homologous recombination; a molecular basis for understanding how this DNA repair process is disrupted by BRCA2 mutations, which lead to chromosomal instability and cancer
20722102 Of the 173 patients, 43 (25%) were found to have a tubal lesion, including 23% of the BRCA1 mutation carriers and 27% of the BRCA2 mutation carriers.
20721749 Functional analysis of BRCA2 variants using a mouse embryonic stem cell-based assay.
20721747 Development of a scoring method to screen for BRCA1/2 mutations.
20721742 The coding sequence and exon-intron junctions of BRCA1 and BRCA2 were amplified in 24 multiplex PCRs using a single condition.
20721735 Prioritizing candidate genetic modifiers of BRCA1 and BRCA2 using a combinatorial analysis of global expression and polymorphism association studies.
20713847 Case Report: Report BRCA2 mutation in astrocytoma patient who was part of a large breast cancer lineage.
20694749 BRCA2 mutation is associated with very young age of onset of breast cancer.
20683152 BRCA2 germline mutation is associated with breast and ovarian cancer.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20676756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20665887 Observational study of gene-disease association. (HuGE Navigator)
20652400 demonstrate significant quantitative differences regarding the production of the BRCA2 full length RNA and the transcript lacking exon 3 in c.156_157insAlu BRCA2 mutation carriers and in controls
20652400 Observational study of gene-disease association. (HuGE Navigator)
20652397 the minor allele del of CASP8 rs3834129 is associated under a dominant model with increased breast cancer risk in carriers of BRCA1 mutations but not in carriers of BRCA2 mutations
20652397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20644999 among BRCA1/2 mutation carriers, prophylactic surgery is cost effective compared to chemoprevention and screening
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20638925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20625126 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20617377 Study in a multi-ethnic (Malay, Chinese, Indian) cohort suggests that large genomic rearrangements are present at a low frequency but should nonetheless be included in the routine testing for BRCA1 and BRCA2.
20614180 Built a classification method that is able to distinguish BRCA2-mutated from sporadic breast tumors based on their chromosomal aberrations with an accuracy of 86.5%.
20614180 Observational study of genetic testing. (HuGE Navigator)
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20609468 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20609467 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608899 The currently presented results validate the suggestion that all patients with FANCD1 should be tested for BRCA2 mutations irrespective of whether the family history meets the BRCA cancer criteria.
20606085 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20589654 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20579331 BRCA2 genes mutations are responsible for a significant proportion of breast cancer.
20570322 Approximately 30% of women with fallopian tube cancer have a mutation in BRCA1 or BRCA2.
20570322 Observational study of gene-disease association. (HuGE Navigator)
20567915 BRCA2 mutation is associated with breast and ovarian cancer predisposition families from a North-Eastern Romanian population.
20549370 Observational study of gene-disease association. (HuGE Navigator)
20541936 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20537530 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20535403 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20513533 Interaction between BRCA1/BRCA2 and ATM/ATR associate with breast cancer susceptibility.
20513533 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20513136 Data identified splicing aberration for BRCA1c.4868C>G(p.Ala1623Gly) and BRCA2c.7988A>T(p.Glu2663Val) and c.8168A>G(p.Asp2723Gly).
20512419 BRCA2 mutation is associated with breast and ovarian Neoplasms.
20507642 Analysis of BRCA2 c.8308 G > A by mRNA analysis, and BRCA2 c.8962A > G, BRCA2 c.8972G > A, BRCA2 c.9172A > G, and BRCA2 c.9213G > T by a minigene assay, revealed no evidence for aberrant splicing.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20482762 Observational study of gene-disease association. (HuGE Navigator)
20473725 In total, 5-10% of all breast cancer cases are related to gen mutations. In most cases a mutation in the BRCA1-gen and BRCA2-gen is responsible for insufficient repair of DNA damages that cause breast and ovarian cancer.
20472656 This study assessed the pathological mutation detection rates for BRCA1, BRCA2 and the CHEK2c.1100 delC mutation in 2022 women with breast cancer, including 100 with breast/ovary double primary and 255 with bilateral breast cancer.
20472656 Observational study of gene-disease association. (HuGE Navigator)
20459916 Observational study of gene-disease association. (HuGE Navigator)
20458532 Data suggest that breast cancer risk among mutation-negative women from BRCA1/2 mutation-positive families is similar to that observed in the general population.
20455026 we report the first identification of a Danish breast and ovarian cancer family heterozygote for mutations in the BRCA1 and BRCA2 genes
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452659 Authors studied 103 women with fallopian tube cancer (48 with a BRCA1 mutation, 12 with a BRCA2 mutation and 43 with no identified BRCA mutation) and 980 matched controls.
20452659 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20443055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20434624 plays important role in susceptibility to breast cancer in middle aged Chinese women
20422428 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20421506 The observed physical association of p53 and BRCA2 may have important functional implications in the p53 transactivation-independent suppression of homologous recombination.
20418484 New loci appeared to interact multiplicatively for breast cancer risk in BRCA1 and BRCA2 carriers.
20418484 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20411323 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20411314 study has informed the development of an appropriate support network based on a hub and spoke model to help BRCA1/BRCA2 carriers and their families adapt to living and coping with their genetic risk
20406939 Data extend the ovarian BRCAness phenotype, imply BRCA1/2-deficient ovarian cancer is biologically distinct, and suggest that patients with visceral metastases should be considered for BRCA1/2 sequencing.
20396944 Letter: Developed high-resolution melting analysis for mutation screening assays for two BRCA2 founder mutations in Chinese breast cancer patients.
20383589 8 novel molecular changes were identified in the BRCA2 gene in 105 investigated breast cancer patients
20383578 Receipt of BRCA1/2 mutation test results impacts how carriers see the positive aspects of risk reducing oophorectomy/mastectomy and their surgical intentions.
20380699 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20376556 BRCA2 mutation does not affect either short-term or long-term survival rate in breast cancer. Review.
20376556 Meta-analysis of gene-disease association. (HuGE Navigator)
20373018 Case Reports: Report double heterozygosity for BRCA1 and BRCA2 mutations and the pathological features of breast/ovarian neoplasms that develop.
20368571 The risks of subsequent contralateral breast cancer are substantial for women who carry a BRCA1/BRCA2 mutation.
20368571 Observational study of gene-disease association. (HuGE Navigator)
20361264 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20356927 BRCA2 does not regulate cytokinesis in human cells.
20353281 analysis of locally prevalent BRCA1/2 mutations in all breast cancer patients might extend substantially the percentage of identified mutation carriers.
20353281 Observational study of gene-disease association. (HuGE Navigator)
20337906 Observational study of gene-disease association. (HuGE Navigator)
20309627 Data suggest that the risk for breast cancer among BRCA1 or BRCA2 carriers may be modified by reproductive characteristics and alcohol use.
20309627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306497 The study results suggest that genes that act upstream of p53, or participate in the DNA damage response, may modify the risk of cancer in women with mutant BRCA1/2 alleles.
20306497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20234365 Rates of new primaries are predicted to some extent by mutation status
20234365 Observational study of gene-disease association. (HuGE Navigator)
20234119 BRCA2 mutation is associated with increases in breast cancer worry in African American women.
20232139 Report a novel complex mutation that consists of a deletion of 12 bp and an insertion of 2 bp (c.8402_8413del12ins2bp) in the exon 18 of the BRCA2 gene in a Spanish hereditary male/female breast cancer family.
20221693 Major gene rearrangements involving the BRCA1 and BRCA2 genes appear to contribute little to the burden of inherited predisposition to breast and ovarian cancer in the Ashkenazim.
20221693 Observational study of gene-disease association. (HuGE Navigator)
20219108 Observational study of gene-disease association. (HuGE Navigator)
20216074 Hereditary breast and ovarian cancer due to mutations in BRCA2 (Review)
20215541 A high proportion of DNA variants of BRCA2 is associated with aberrant splicing in breast/ovarian cancer patients.
20215531 BRCA2 mutation carriers had an increased risk of prostate cancer and a higher histologic grade, and BRCA1 or BRCA2 mutations were associated with a more aggressive clinical course.
20215531 Observational study of gene-disease association. (HuGE Navigator)
20206018 Observational study of gene-disease association. (HuGE Navigator)
20204502 The incidence of breast and ovarian cancer in BRCA2 mutation carriers and of ovarian cancer in BRCA1 mutation carriers is still high after 60 years.
20204502 Observational study of gene-disease association. (HuGE Navigator)
20202217 BRCA2 gene promoter has bi-directional activity, expressing BRCA2 and a novel C4-type zinc finger containing transcription factor ZAR2.
20199546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195775 the prevalence of BRCA2 mutations in the German familial pancreatic cancer population is less frequent than previously reported
20180971 Observational study of gene-disease association. (HuGE Navigator)
20180014 Occult ovarian cancers may be found at the time of risk-reducing salpingo-oophorectomy in BRCA1/2 mutation carriers.
20174566 These results suggest that, compared to BRCA1 and BRCA2 mutation carriers, non-BRCA1/2 (BRCAX) individuals are genetically heterogeneous.
20151938 Observational study of gene-disease association. (HuGE Navigator)
20135348 No large genomic rearrangements were detected in the BRCA2 gene in Czech high-risk breast/ovarian cancer patients.
20135345 Meta-analysis suggests that the BRCA2 372H allele may be a low-penetrant risk factor for developing breast cancer.
20135344 Chemotherapy and tamoxifen reduced the risk of contralateral breast cancer in BRCA1/BRCA2 carriers and non-carriers to a similar relative degree.
20134318 The prophylactic procedure is highly effective in preventing invasive breast cancer in BRCA2 mutation carriers
20130978 None of the associations between reproductive factors and contralateral breast cancer risk differed between BRCA2 mutation carriers and non-carriers.
20104584 analysis of BRCA1 and BRCA2 deleterious mutations and variants of unknown clinical significance in unilateral and bilateral breast cancer
20077502 analysis of cancer predisposing missense and protein truncating BARD1 mutations in non-BRCA1 or BRCA2 breast cancer families
20059483 The aim of this study is to outline the uptake of risk-reducing surgery in the Danish population of BRCA mutation positive women and to search for factors affecting this decision.
20043088 Observational study of gene-disease association. (HuGE Navigator)
20033769 Observational study of gene-disease association. (HuGE Navigator)
20033483 the population of Eastern Spain showed a great heterogeneity in the BRCA1 and BRCA2 mutations
20020529 Multifactorial likelihood analysis indicates that the BRCA1 c.135-1G>T and BRCA2 c.7977-1G>C variants are disease-associated mutations which should be managed clinically in the same fashion as classical truncating mutations.
20010525 variant genotypes of the Thr1915Met and Met784Val polymorphisms of the BRCA2 gene may be indicative factors in therapy of ductal breast cancer
20010525 Observational study of gene-disease association. (HuGE Navigator)
19996031 Observational study of genetic testing. (HuGE Navigator)
19996028 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19949853 Report BRCA2 Spanish proven founder mutations which predispose to breast cancer in young women.
19949853 Observational study of gene-disease association. (HuGE Navigator)
19941167 Observational study of genotype prevalence. (HuGE Navigator)
19921428 Observational study of gene-disease association. (HuGE Navigator)
19920816 the role of a SNP in intron 1 of the ERCC4 gene (rs744154), previously reported to be associated with a reduced risk of breast cancer in the general population, as a breast cancer risk modifier in BRCA1 and BRCA2 mutation carriers.
19920816 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903338 Observational study of gene-disease association. (HuGE Navigator)
19902366 Data show that although SNPs in BRCA2 and ERCC2 showed stronger associations with high Gleason score, results were not statistically significantly different between clinically aggressive and non-aggressive tumors.
19902366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19899408 Observational study of gene-disease association. (HuGE Navigator)
19898224 Multistep level sections to detect occult fallopian tube carcinoma in risk-reducing salpingo-oophorectomies from women with BRCA mutations: implications for defining an optimal specimen dissection protocol.
19885732 In this prospective study of women who were unaffected at the time of genetic testing and who were negative for the known familial mutation in BRCA1/2, no excess risk of invasive breast cancer was observed.
19877752 5382insC and 185delAG mutations in BRCA1 and 6174delT in BRCA2 have much less frequency in Iranian breast cancer patients.
19877752 Observational study of gene-disease association. (HuGE Navigator)
19877382 Observational study of gene-disease association. (HuGE Navigator)
19876733 The ITGB3 Leu33Pro polymorphism does not modify breast or ovarian cancer risk in BRCA2 mutation carriers.
19876733 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19875889 151 consecutive primary ovarian tumors (including 21 with BRCA1/2 mutations and 130 without the mutations) were screened for loss of heterozygosity at loci on chromosomes 17 and 13q.
19863560 a predisposing mutation in BRCA2,is present in approximately 6% of French-Canadian women with early-onset breast cancer
19863560 Observational study of gene-disease association. (HuGE Navigator)
19861517 Observational study of gene-disease association. (HuGE Navigator)
19858402 Examine contralateral breast cancer risk in BRCA1 and BRCA2 mutation carriers.
19858402 Observational study of gene-disease association. (HuGE Navigator)
19851859 BRCA2 germline mutation in a juvenile breast carcinoma diagnosed at 21 years of age, 4 years after an early full-term pregnancy, in absence of cancer family history
19843326 Study investigated the role of genetic variation in IGF signaling and breast cancer risk in women carrying deleterious mutations in BRCA1 and BRCA2.
19843326 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19841329 BRCA2 mutation testing is associated with ovarian cancer prevention.
19818997 AR allelotype length did not correlate with survival in this statistically representative cohort of patients with BRCA1/2 mutations. Associations between short AR and outcome in BRCA2-associated ovarian cancers remain to be determined.
19818997 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19805903 BRCA2 germ-line mutation analysis among Indian women from south India identified novel mutations and a high-frequency occurrence of a base-pairing gene deletion.
19802015 Study identified linkage disequilibrium between KL-VS and BRCA2 6174delT mutation on 13q12.
19798417 analysis of BRCA1/2 mutation-carrying and non-mutation-carrying high-grade serous carcinomas of ovary
19795125 Cancers with a BRCA2 germ line mutation are less frequent and resemble sporadic cases with a comparably higher proliferative activity and a lack of Her2 overexpression.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19787003 Breast cancer in a BRCA2 mutation carrier with a history of prostate cancer is reported.
19780858 there was no significant difference in cyclin D1 expression between BRCA2 and BRCAX cancers
19773279 Observational study of gene-disease association. (HuGE Navigator)
19752737 Observational study of genetic testing. (HuGE Navigator)
19748364 Recruitment of fanconi anemia and breast cancer proteins to DNA damage sites is differentially governed by replication.
19745749 Nomenclature for BRCA1/2 DNA test.
19737859 among the 13 known Fanconi Anemia genes, only FANCD1/BRCA2 plays a major role in high-risk breast cancer predisposition
19715467 a novel pathogenic mutation in BRCA2; (c.2999delCT,frameshift mutation consists of a deletion of two bases in exon 11)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19709076 BRCA2-plectin interaction plays an important role in the regulation of centrosome localization and also that displacement of the centrosome may result in genomic instability and cancer development.
19707196 There was no evidence that TP53 Arg72Pro or MDM2 309T>G, either singly or in combination, influence breast cancer risk in BRCA1 or BRCA2 mutation carriers.
19707196 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19704162 PCNA may function as a molecular platform to facilitate the mono-ubiquitination of FANCD2 and activation of the FA-BRCA pathway
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19669600 BRCA1/2 genomic rearrangement is likely to make only a small contribution to breast cancer in the Korean population.
19661094 Heterozygosity and homozygosity of any of the examined nine BRCA1 and BRCA2 missense polymorphisms cannot explain the increased risk of breast and/or ovarian cancer observed in families with hereditary breast and/or ovarian cancer.
19661094 Observational study of gene-disease association. (HuGE Navigator)
19661089 Observational study of gene-disease association. (HuGE Navigator)
19656774 SNP rs13281615 at 8q24 was not associated with breast cancer for either BRCA1 or BRCA2 mutation.
19656774 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19656415 Observational study of gene-disease association. (HuGE Navigator)
19656164 This study suggests the possibility of the first true founder mutation of BRCA1/BRCA2 identified in the Korean population.
19656163 Alterations in BRCA2 gene sequence, copy number, or expression are extremely common in clear cell carcinoma of the ovary and may contribute to a paradoxical better clinical outcome.
19654294 restoration of BRCA2 due to secondary BRCA2 mutation is involved in acquired drug resistance of BRCA2-mutated ovarian carcinoma.
19649760 Observational study of gene-disease association. (HuGE Navigator)
19649703 we identified a novel germ line mutation in the BRCA2 gene (c.51dupA) in a patient with early onset bilateral breast cancer and no family history of the disease
19649554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19644020 Observational study of genetic testing. (HuGE Navigator)
19642207 Observational study of gene-disease association. (HuGE Navigator)
19628690 BRCA2 targets RAD51 to ssDNA while inhibiting dsDNA binding and that these contrasting activities together bolster one another to stimulate homologous DNA recombination.
19626602 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19620486 immunohistochemistry-based test (which takes only 4 hours) appears to identify BRCA2 hereditary cancer with high accuracy.
19619314 analysis of BRCA1 and BRCA2 germline mutations in breast cancer susceptibility within Sardinian population
19619314 Observational study of gene-disease association. (HuGE Navigator)
19617217 A synonymous variant (Ser51) in TOX3 (previously TNRC9) was associated with an increased risk of breast cancer (OR=1.82, p<0.001) in BRCA2 mutation carriers.
19617217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19616529 Observational study of genetic testing. (HuGE Navigator)
19609668 surveillance and prevention strategies may have different outcomes in BRCA1 and BRCA2 mutation carriers
19609668 Observational study of gene-disease association. (HuGE Navigator)
19609323 structure explains the effects of both cancer-associated truncating mutants in PALB2 and missense mutations in the amino-terminal region of BRCA2.
19606050 Observational study of genetic testing. (HuGE Navigator)
19597986 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19584580 Observational study of gene-disease association. (HuGE Navigator)
19584272 Data show that variants in genes that interact biologically with BRCA1 and/or BRCA2 may be associated with modified ovarian cancer risk in women who carry BRCA1/2 mutations.
19584272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19584259 Show here that PALB2 physically and functionally connects BRCA1 and BRCA2 into a DNA damage response network that also includes the RAD51 recombinase.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19578754 CBP-mediated post-translational N-glycosylation of BRCA2.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19564533 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19553641 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19549900 Role of MCPH1 in the DNA damage response is in part associated with the ability to localize BRCA2 to sites of DNA double-stand breaks.
19549808 BRCA mutation carriers, as well as women with a significant family history of breast and ovarian cancer are more vulnerable to exogenous hormones in oral contraceptives
19549808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19548527 Observational study of gene-disease association. (HuGE Navigator)
19543244 Observational study of gene-disease association. (HuGE Navigator)
19540122 Results suggest that Rad51 binding by the C-terminal Brca2 motif is dispensable for the execution of homologous DNA recombination but instead links the disassembly of Rad51 complexes to mitotic entry.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19530235 two siblings diagnosed with central nervous system embryonal tumors at an early age in association with biallelic BRCA2 inactivation, including the first reported case of a spinal cord primitive neuroectodermal tumor (PNET) in a BRCA2/FANCD1 kindred
19499246 The proportion of Korean ovarian cancer patients with a strong family history was significant, and the prevalence of BRCA1 and BRCA2 mutations in such patients was high.
19499246 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19491894 Observational study of gene-disease association. (HuGE Navigator)
19491284 Prevalence of BRCA2 mutation and risk of secondary malignancies across diverse racial groups in young women with breast cancer are reported.
19491284 Observational study of gene-disease association. (HuGE Navigator)
19478387 Primary human fibroblasts derived from heterozygous BRCA2 mutation carriers show significantly prolonged cytokinesis.
19473207 germ line BRCA2 gene mutation may play a role in familial aggregation of ESCC in high-risk region of India.
19473207 Observational study of gene-disease association. (HuGE Navigator)
19454451 Review states that referral criteria for BRCA1 genetic testing may differ between European countries based on BRCA2 mutation prevalence.
19383376 review of available data on ovarian cancers in the context of other investigations of BRCA-related transcriptional alterations , and highlight areas for future research.
19383375 REVIEW: Germline mutations of the BRCA1 and BRCA2 genes confer a high life-time risk of ovarian cancer
19383374 REVIEW: BRCA1 and BRCA2 gene mutations which predispose to the hereditary breast-ovarian cancer syndrome
19383373 REVIEW: BRCA1 and BRCA2 gene mutations which predispose to the hereditary breast-ovarian cancer syndrome
19377795 The prevalence of germline mutations in the BRCA1 and BRCA2 genes found was lower than reported on high-risk Brazilian populations.
19377795 Observational study of gene-disease association. (HuGE Navigator)
19372713 It was shown that the presence of the mutations in the BRCA1/2 genes among patients with bilateral breast cancer is associated with an earlier occurrence of the first and the second breast cancer than in patients without hereditary mutations.
19372713 Observational study of gene-disease association. (HuGE Navigator)
19370414 parity appears to be associated with protection from breast cancer in women with mutations in BRCA1 and BRCA2
19370414 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19369211 impaired homologous recombination repair is one of the fundamental causes for genomic instability and tumorigenesis observed in patients carrying BRCA1, BRCA2, or PALB2 mutations
19353265 We identified seven (7/22, 31.8%) new deleterious mutations and also confirmed and reported a BRCA2 founder mutation in our Hong Kong Chinese cohort
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19340607 promoter methylation is a not a frequent "second-hit" in tumors from BRCA1 or BRCA2 carriers.
19338682 Observational study of gene-disease association. (HuGE Navigator)
19329713 Observational study of gene-disease association. (HuGE Navigator)
19307946 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19303847 Study shows that the solitary BRC4 amino motif of BRCA2 promotes assembly of RAD51 onto single-stranded DNA, but not dsDNA, to stimulate DNA strand exchange.
19298662 Observational study of gene-disease association. (HuGE Navigator)
19288190 We report a novel germline 5369delATTT mutation in BRCA2 gene, detected in a 45-year-old woman with bilateral breast cancer. This deletion was also detected in her father with prostatic cancer and her sister with breast cancer.
19277124 Observational study of gene-disease association. (HuGE Navigator)
19268590 BRCA1 is an upstream regulator of BRCA2 in the DNA-damage response, and PALB2 is the linker between BRCA1 and BRCA2 in breast and ovarian cancer.
19267246 the BRCA2 silent mutation Lys172Lys is a disease-causing mutation.
19258944 Observational study of gene-disease association. (HuGE Navigator)
19258476 Observational study of gene-disease association. (HuGE Navigator)
19253839 The genotype HH of the N372H locus in BRCA2 is associated with breast cancers.
19253839 Observational study of gene-disease association. (HuGE Navigator)
19241424 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19232099 In Sardinian breast cancer population, effects of BRCA2 germline mutations on survival varied within the first 2 years from diagnosis. After longer follow-up, breast cancer-specific rates of death were similar for BRCA2 mutation carriers and non-carriers.
19232099 Observational study of gene-disease association. (HuGE Navigator)
19229607 two codon-usage-changing variants were detected in BRCA2 in familial breast cancer but showed no association with breast cancer risk
19229607 Observational study of gene-disease association. (HuGE Navigator)
19226467 MDM2SNP309G/G main effect on BRCA1/2 positive mutation carriers is linked to its effect on patients survival.
19226467 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19214744 the CASP8 D302H polymorphism diminishes the high risk of breast cancer conferred by BRCA1 and BRCA2 mutations
19214744 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19200971 There was no difference in mean parity between carriers (1.9) and noncarriers (1.9)of BRCA mutations.
19200971 Observational study of gene-disease association. (HuGE Navigator)
19200354 Genetic variants in the BRCA2 gene is associated with breast cancer.
19200354 Observational study of genetic testing. (HuGE Navigator)
19190154 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19189213 It is possible that GATA3 mutations occur earlier in the evolution of breast tumors, compared to BRCA1, BRCA2 or sporadic tumors, and are therefore easier to detect by direct sequencing in the presence of some stromal contamination.
19188187 Observational study of gene-disease association. (HuGE Navigator)
19179552 Two mutations of BRCA2 gene at exon and splicing site in a woman who underwent oncogenetic counseling. (Case report)
19176389 BARD1 has BRCA1-dependent and BRCA1-independent functions in mitosis. BARD1, but not BRCA1, localizes to the midbody at telophase and cytokinesis, where it colocalizes with Aurora B.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165595 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139771 Three hundred and forty-five probands were examined for specific mutations of BRCA1/2 genes. The estimated penetrance for the age groups among BRCA1/2 carriers was 31.9% (<50 years) and 46.2% (> or =50 years
19139771 Observational study of gene-disease association. (HuGE Navigator)
19125001 The oral contraceptive pill (OCP) reduces the risk of both endometrial and ovarian cancer in the general population and BRCA carriers
19124506 Observational study of gene-disease association. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19087709 Observational study of gene-disease association. (HuGE Navigator)
19083511 The BRCA2 gene, found on the long arm of chromosome 13, encodes for an even larger protein of 3418 amino acids.BRCA 1 and 2 mutations account for 5% to 10% of breast cancer cases.
19082709 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19070627 BRCA2 IVS4-12del5 is a deleterious mutation.
19066131 BRCA2 gene mutation is associated with breast and ovarian cancer.
19066131 Observational study of gene-disease association. (HuGE Navigator)
19064968 Consistent with previous reports, BRCA2 mutations are associated with an increased risk of PAC.
19064968 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19035463 analysis of the effectiveness of screening in diagnosing early stage ovarian cancer in BRCA1 and BRCA2 mutation carriers
19030985 BRCA2 T1915M polymorphism alone might be associated with a reduced risk of breast cancer, but among CHEK2 mutation carriers, it may lead to an unexpectedly high risk.
19030985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19016756 Cross-sectional analysis of germ-line BRCA2 mutations in Japanese patients suspected to have breast/ovarian cancer is reported.
19016756 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19012002 Studied BRCA1 and BRCA2 exp'n in young breast cancer patients;BRCA1 & BRCA2 expression correlated in healthy, but not in tumor tissues. Neither BRCA1 nor BRCA2 exp'n was assoc'd with tumor histology, diff'n, nodal metastasis or p53 and HER-2 exp'n.
19011960 analysis of novel mutations identified in Slovak HBOC families, c.80 + 3del4 (IVS2 + 3delAGTC) in BRCA1 gene and mutation c.6589delA (6817delA) in BRCA2 gene [case report]
19011769 no defect in FANCD2 ubiquitination, BRCA2 and FANCJ expression; absence of FANCN protein in three cell lines: HT, Sudhl4 and JEKO-1.
19010876 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19009954 Carriers of mutations in the genes BRCA1/2 may present a specific high risk group for PABC especially at younger ages.
18990759 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18990703 Parp-1 down-regulates BRCA2 expression through an interaction with a repression region of the BRCA2 promoter
18955455 germ-line BRCA1 or BRCA2 mutations may have a role in response to primary platinum-based chemotherapy
18955455 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18940471 C-terminally truncated BRCA2 hinders RAD51 nuclear translocation, possibly contributing to genetic instabilities in homozygous as well as heterozygous individuals.
18936947 no association between duration of epithelial ovarian cancer symptoms and BRCA mutation status
18855126 Observational study of gene-disease association. (HuGE Navigator)
18844490 In a population well beyond the average age of breast/ovarian cancer onset, 21 different sequence variants in the BRCA1 gene (one novel) and 36 variants in the BRCA2 gene (7 novel) were detected.
18844490 Observational study of genotype prevalence. (HuGE Navigator)
18842997 Observational study of gene-disease association. (HuGE Navigator)
18841560 possible relationship between defects in the FA/BRCA pathway of genomic stability and potential pathogenesis of T and B cell lymphoma.
18830263 Observational study of gene-disease association. (HuGE Navigator)
18819001 BRCA2 mutation is associated with male breast cancer.
18819001 Observational study of gene-disease association. (HuGE Navigator)
18807178 Observational study of genetic testing. (HuGE Navigator)
18797466 a link between CHEK2 and BRCA2 pathways
18794105 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18783588 A high mutation detection rate and the frequent occurrence of a limited array of recurring mutations allow a simple and fast initial test for BRCA1/2 mutation screening in families with Slovenian ancestry
18779615 Observational study of gene-disease association. (HuGE Navigator)
18779604 Observational study of genetic testing. (HuGE Navigator)
18776644 Methylation status of CpG islands at sites -59 to +96 in exon 1 varies in mammary tissue among women with sporadic breast cancer
18765668 Different from ERbeta, p53 interacts with HDAC1 and CtBP1 and forms an inhibiting transcriptional complex that could compete for binding to Sp1 sites with ERalpha transcriptional complex and inhibit BRCA2 transcription more significantly
18758995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18752448 BRCA1/2 in high-risk African-American women with breast cancer: providing genetic testing through various recruiment strategies is reported.
18717684 The study demonstrates for the first time that microsatellite-stable FHIT-negative sebaceous gland carcinomas accumulate mutations that target central components of the HRR network.
18712473 Our aim was to ascertain the pathological effect of the BRCA1 IVS6-1G>A (c. 302-1G>A) and the BRCA2 IVS15+1G>A (c. 7617+1G>A) variants detected in Spanish breast/ovarian cancer families
18710587 analysis of breast cancer risk variation in BRCA1 and BRCA2 mutation carriers
18703817 BRCA1 and BRCA2 genomic rearrangement testing be considered in all non-Ashkenazi Jewish women with an estimated mutation prevalence >or=10%
18703817 Observational study of gene-disease association. (HuGE Navigator)
18694767 characterized BRCA1 and BRCA2 gene polymorphic variants in familial breast cancer
18679827 a limited role for the three Ashkenazi BRCA1/2 founder mutations in cutaneous malignant melanoma risk among the Ashkenazi Jewish population
18679827 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18663943 Observational study of gene-disease association. (HuGE Navigator)
18645608 Observational study of gene-disease association. (HuGE Navigator)
18642075 we determined the methylation statuso f the promoter in putative modifier genes: BRCA1, BRCA2, ATM, ATR and P53 in Jewish BRCA1/BRCA2 mutation carriers with or without breast cancer. hypermethylation was detected only in the BRCA1 promotor
18632222 alteration in RAD51 region may contribute to the disturbances of DNA repair involving RAD51 and/or BRCA2 penetration and thus enhance the risk of breast cancer development.
18627636 analysis of BRCA1 and BRCA2 mutations in Malaysia
18627636 Observational study of genetic testing. (HuGE Navigator)
18618591 BRCA2 deficiency is partially rescued by Rad51 overexpression
18597679 the novel BRCA2 splice variant is a de novo mutation introduced in the male spermatozoa that can be classified as a disease causing mutation
18593900 A syngeneic variance library for functional annotation of human variation in BRCA2.
18579371 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18577985 The median survival from diagnosis of prostate cancer was 4.0 years for men with a BRCA2 mutation vs 8.0 years for men with a BRCA1 mutation, and the difference was highly significant.
18577985 Observational study of gene-disease association. (HuGE Navigator)
18574689 our findings suggest no difference in the occurrence of miscarriage between BRCA2 carriers and non-carriers when parental consanguinity was taken into consideration
18563556 BRCA2-associated cancers were characterized by the higher relative expression of FGF1 and FGFR2
18559594 BRCA1 and BRCA2 mutation prevalence and clinical characteristics of a population-based series of ovarian cancer cases from Denmark.
18559594 Observational study of gene-disease association. (HuGE Navigator)
18559571 There is a highly significant reduction in life expectancy in BRCA1 compared to BRCA2 carriers in ovarian cancer.
18559571 Observational study of gene-disease association. (HuGE Navigator)
18553220 Single nucleotide polymorphism in BRCA2 is associated with breast cancer.
18553220 Observational study of gene-disease association. (HuGE Navigator)
18543099 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18528753 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
18523885 TGFB1 L10P genotype does not modify the risk of breast cancer in BRCA1 or BRCA2 mutation carriers
18523885 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18513387 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
18509731 A case-control study is reported on infertility, treatment of infertility, and the risk of breast neoplasms among women with BRCA2 mutations.
18509731 Observational study of gene-disease association. (HuGE Navigator)
18501021 No large genomic rearrangements were identified in BRCA2 in Finnish breast and/or ovarian cancer families
18497862 BRCA1 and BRCA2 mutation carriers had similar expression profiles, with some subclustering of missense mutation carriers.
18489799 deleterious genetic variants in the BRCA2 gene in the Czech population
18489799 Observational study of gene-disease association. (HuGE Navigator)
18483851 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18481196 Observational study of gene-disease association. (HuGE Navigator)
18465347 The mutation distributions are comparable with those from Scandinavian and European studies and indicate that the Danish BRCA1 and BRCA2 mutations are a mixture of Scandinavian mutations and European mutations including two of the Ashkenazi mutations.
18463975 Genome-wide association study of gene-disease association. (HuGE Navigator)
18451254 Observational study of gene-disease association. (HuGE Navigator)
18451181 An excellent method for identifying inactivating missense mutations in the BRCA2 DBD predicting likelihood of cancer in carriers.
18445692 These observations are consistent with the idea that BRCA2, but not BRCA1, is a tumor suppressor of prostate cancer.
18439109 In Ashkenazi Jews, mutations in BRCA1/2 may constitute a major cause for pancreatic cancer.
18439109 Observational study of gene-disease association. (HuGE Navigator)
18439106 BRCA2 gene mutation was identified in 4 male breast cancer (MBC) patients; 3 carried the Slovenian founder mutation IVS16-2A>G; all 4 mutations were confined to patients with a family history of breast cancer
18439040 caspase 3 cleavage of Rad51 resulted in a functional decrease in Rad51 strand exchange activity and that inhibition of caspase 3 activity increased Rad51 protein levels and Rad51 foci
18437078 BRCA2 mutation may not contribute to increases in the risk for both sporadic and familial pancreatic cancer in Korea.
18437078 Observational study of gene-disease association. (HuGE Navigator)
18434071 Observational study of gene-disease association. (HuGE Navigator)
18431743 Meta-analysis of gene-disease association. (HuGE Navigator)
18431737 Observational study of gene-disease association. (HuGE Navigator)
18431501 A total of 14 BRCA1 and 17 BRCA2 sequence alterations, of which eight are novel, are reported.
18431501 Observational study of gene-disease association. (HuGE Navigator)
18429825 Dinucleotide CA repeat polymorphism at RAD51 and BRCA2 gene regions might be associated with genetic susceptibility to breast cancer.
18429825 Observational study of gene-disease association. (HuGE Navigator)
18413372 Survival from diagnosis of ovarian cancer was calculated using Kaplan-Meier and compared for proven BRCA1/2 carriers with non-carriers; 5 & 10 year survival in BRCA1/2 mutation carriers was 58.6% and 36%, which was sig. worse than for non-BRCA carriers.
18413372 Observational study of gene-disease association. (HuGE Navigator)
18402691 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18393245 BRCA2 may play an important role in the familial breast cancer in eastern Shandong Chinese population, but not in the early-onset breast cancer.
18393245 Observational study of gene-disease association. (HuGE Navigator)
18380995 The most current evidence suggests that it may be more beneficial in those with BRCA2 mutations because tumors associated with these mutations are likely to be estrogen-receptor positive.
18377429 Down-regulation of BRCA2 leads to radio-sensitization mainly through the inhibition of homologous recombination repair type double-strand break repair.
18375895 We studied 10 BRCA1 and 12 BRCA2 variants identified in Australian families with breast cancer.
18363094 contribution of Alu insertion in BRCA2 exon 3(c.156_157insAlu) to inherited predisposition to breast/ovarian cancer in families mostly from northern/central Portugal; findings show it accounts for more that one-fourth of deleterious BRCA1/BRCA2 mutations
18355772 The differences in the effects of the FGFR2 and MAP3K1 SNPs between BRCA1 and BRCA2 carriers point to differences in the biology of BRCA1 and BRCA2 breast cancer tumors and confirm the distinct nature of breast cancer in BRCA1 mutation carriers.
18355772 Meta-analysis of gene-disease association. (HuGE Navigator)
18342932 Tubal p53 signature merits serious consideration as an important early event in serous carcinogenesis in BRCA+ women.
18327210 Cyclin D1 expression analysis in familial breast cancers may discriminate BRCAX from BRCA2-linked cases.
18317453 Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage
18312450 56 mutations were identified in BRCA2 in families containing at least one reported ovarian cancer diagnosed less than 50 years or at any age with family history of breast or ovarian cancer for mutations in BRCA1 and BRCA2.
18307534 A novel BRCA2-interacting protein, BJ-HCC-20A, which is reported to be a potential cancer-testis antigen, was idenified.
18288416 The BRCA2 N372H and the IVS21-66T>C polymorphisms increase breast cancer risk.
18288416 Observational study of gene-disease association. (HuGE Navigator)
18286383 Association between BRCA2 mutations and the presence of breast cancer in a Cuban population.
18286383 Observational study of genotype prevalence. (HuGE Navigator)
18285832 BRCA2 mutation is associated with breast cancer
18284688 Observational study of gene-disease association. (HuGE Navigator)
18283561 This articles reviews the evidence for the association of BRCA2 polymorphisms and the development of breast neoplasms.
18279628 Observational study of genotype prevalence. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18258506 we review the DNA-damage response network consisting of FA and BRCA proteins and what is known about their involvement in breast cancer susceptibility
18257128 review of BRCA1/2 associated hereditary breast cancer [review]
18256760 incidence of mutations in the BRCA1 and BRCA2 genes in the studied sampling of 74 patients with ovarian cancer was 19%; majority of mutations (86%) were detected in BRCA1 gene, where 5382insC mutation predominated (58%)
18256760 Observational study of genotype prevalence. (HuGE Navigator)
18214034 The 4088insA mutation appears to be associated with a favourable clinical course of breast and ovarian cancer
18212739 FANCG promotes formation of a newly identified protein complex containing BRCA2, FANCD2 and XRCC3.
18204050 Allelic imbalance affecting BRCA1 and to a lesser extent BRCA2 may contribute to both familial and non-familial forms of breast cancer.
18200524 Mutation of BRCA2 gene is an indication of susceptibility to breast and ovarian neoplasms.
18182994 Since BRCA1/2 mutation carrier status is associated with more aggressive disease, it is a prognostic factor for PRCA outcome.
18182994 Observational study of gene-disease association. (HuGE Navigator)
18182601 Observational study of gene-disease association. (HuGE Navigator)
18178637 In summary, BRCA2 clearly accounts for a proportion of LFS/LFL (Li-Fraumeni syndrome, LFS-like) families negative for TP53. mutations.
18176857 heterogeneous ethnicity increases the variety of BRCA1 and BRCA2 mutations that can be found in Spanish populations
18176857 Observational study of genotype prevalence. (HuGE Navigator)
18175216 The CHEK2 1100delC mutation is not present in Korean patients with breast cancer cases tested for BRCA1 and BRCA2 mutation
18175216 Observational study of genotype prevalence. (HuGE Navigator)
18175183 Observational study of gene-disease association. (HuGE Navigator)
18172292 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18172190 Meta-analysis of gene-disease association. (HuGE Navigator)
18167127 BRCA2 protein is lost in carcinoma cells compared to normal and hyperplastic prostate epithelium
18165636 Observational study of gene-disease association. (HuGE Navigator)
18165636 study confirms that, among Ashkenazi ovarian cancer patients, BRCA1/2 mutations are associated with improved long-term survival
18158280 Founder BRCA2 mutation is associated with male breast cancer
18158280 Observational study of genotype prevalence. (HuGE Navigator)
18098285 models used to analyze age-incidence curve of breast cancer in women carrying gerrmline BRCA1 or BRCA2 mutations; results suggest in carriers there are 2 events which may occur at rates similar to mutation rates for normal cells leading to breast cancer
18097605 Sixty-four Polish families with a history of breast and/or ovarian cancer were screened for mutations in the BRCA1/2 genes
18095987 Loss of heterozygosity of the BRCA2 gene region was found to be common in the cutaneous squamous cell carcinoma.
18095154 analysis of breast cancer genes that may modify risk in BRCA1/2 mutation carriers
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18092194 BRCA1/2 mutations are significantly more common in Italian women who developed breast cancer
18092194 Observational study of gene-disease association. (HuGE Navigator)
18086758 Observational study of gene-disease association. (HuGE Navigator)
18060494 BRCA2 mutations are associated with breast and ovarian cancer.
18059333 depletion of normal BRCA2 proteins in the cytoplasm leads to centrosome amplification and binucleated cells. Our results suggest that disruption of NES function by genetic changes results in deregulation of BRCA2 export, which leads to centrosome disorder
18045956 BRCA1/2 mutations predispose to early onset breast and ovarian cancers, modified by factors such as IGF-I.
18043900 there is no evidence of sex ratio skewing in offspring of female BRCA mutation carriers
18042939 evaluation of the risks of developing breast carcinoma for male BRCA1 and BRCA2 mutation carriers; both the relative and cumulative risks were higher for BRCA2 mutation carriers than for BRCA1 mutation carriers
18036394 study describes a family with multiple cases of MEN1-associated cancers as well as pancreatic adenocarcinoma, ovarian cancer, and male breast cancer, in which we identified germline mutations in both MEN1 and BRCA2
18034184 Germline mutations in the BRCA1 or BRCA2 tumour-suppressor genes are strong predictors of breast and/or ovarian cancer development.
18026875 MDM2 SNP309 accelerates breast and ovarian carcinogenesis in BRCA1 and BRCA2 carriers of Jewish-Ashkenazi descent.
18026875 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18024013 Observational study of gene-disease association. (HuGE Navigator)
17999359 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17999359 RAD51 is the first gene to be reliably identified as a modifier of risk among BRCA1/2 mutation carriers.
17997147 Observational study of genotype prevalence. (HuGE Navigator)
17977515 We found six differentially expressed proteins; among them, the checkpoint mediator protein MDC1 whose expression was disrupted in FANCC-/- cells.
17972177 Observational study of genotype prevalence. (HuGE Navigator)
17972172 BRCA1 or BRCA2 mutations have roles in breast cancer in smokers
17972172 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17968145 High frequency of BRCA1/2 and p53 somatic inactivation in sporadic ovarian cancer.
17952592 The site of first distant metastasis is different between BRCA1- and BRCA2-associated and sporadic breast cancer patients.
17952592 Observational study of gene-disease association. (HuGE Navigator)
17945002 5' UTR polymorphism in BRCA2 is associated with breast cancer, which is further influenced by the germline genetic backgrounds of codon 72 polymorphism of p53
17945002 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17940634 Tumors are unlikely to arise directly from BRCA2 heterozygous cells without other genetic events such as loss of the wild-type BRCA2 allele and/or loss of p53 function or other cell cycle inhibitors.
17925560 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
17924331 The clinical significance of 1,433 sequence variants of unknown significance (VUSs) in the BRCA genes, was assessed.
17922257 prevalence of BRCA1 & BRCA2 mutations in breast cancer patients with affected relatives in Tunisia; two frameshift mutations (c.1309del4 and c.5682insA) were observed in BRCA2
17917796 Self-image and self-disclosure concerning prophylactic mastectomy (PM) for women with a BRCA1/2 mutation.
17899372 analysis of a subset of unclassified sequence variants in BRCA2 that may adversely affect splicing and thereby contribute to BRCA2 disruption
17898070 Study found that Fanconi anemia pathway activation is triggered mainly by the HPV type 16 (HPV-16) E7 oncoprotein and is associated with an enhanced formation of large FANCD2 foci and recruitment of FANCD2 as well as FANCD1/BRCA2 to chromatin.
17851763 The prevalence of BRCA1 and BRCA2 germline mutations in high-risk breast cancer patients of Chinese Han nationality.
17851763 Observational study of genotype prevalence. (HuGE Navigator)
17850627 analysis of BRCA1 and BRCA2 mutations in Eastern Finnish breast/ovarian cancer families
17767707 Observational study of gene-disease association. (HuGE Navigator)
17767707 the BRCA2 HH homozygous genotype might be positively associated with an increased risk of male breast cancer in men younger than 60 years.
17761984 The greatest proportion of serous cancer risk in BRCA mutation-positive women should be assigned to the fimbria rather than the ovary.
17724471 A suspicious deleterious BRCA2 variant is identified in 15 of 197 cases of esophageal squamous cell carcinoma in the Iranian Turkmen population.
17724471 Observational study of gene-disease association. (HuGE Navigator)
17700570 Observational study of gene-disease association. (HuGE Navigator)
17700570 Results suggest that protein-truncating BRCA2 mutations confer an elevated relative risk of early-onset prostate cancer
17688236 Data indicate that BRCA2 are the major susceptibility genes for ovarian cancer but that other susceptibility genes may exist.
17686574 ectopically BRCA2-expressing cells have different intracellular levels of Aurora A, Aurora B, p21, E2F-1, and pRb, suggesting a BRCA2-mediated suppression of polyploidy via stabilization of the checkpoint proteins levels
17686308 Observational study of genotype prevalence. (HuGE Navigator)
17683622 Inactivation of a single gene within the BRCA2 pathway can increase risks for multiple cancers and inactivation of a different gene in the same pathway may have similar effects.
17673924 Higher BTAK expression was found in ovarian cancer cells compared to ovaries without cancer but with known BRCA1/2 mutation or strong family history.
17664283 Results point to a critical role for BACH1 helicase activity not only in the timely progression through the S phase by association with BRCA1/BRCA2, but also in maintaining genomic stability.
17661168 BRCA1/2 rearrangements is not advantageous in male breast neoplasm (MBC) cases not belonging to high-risk breast cancer families and that common CHEK2 mutations play an irrelevant role in MBC predisposition in Italy.
17657584 The identified BRCA2 c.7806-9T > G [Genbank: DQ889340] was found to be pathogenic in a Chinese family, based on aberrant splicing events resulting in the formation of truncated protein products.
17645508 From a population database of BRCA1 and 2 mutation carriers in Southwestern Ontario, Canada, we identified three women with advanced-stage endometrial cancer.
17640379 Observational study of genotype prevalence. (HuGE Navigator)
17640379 BRCA2-8765delAG has an independent origin in geographically and ethnically distinct populations, acting as a founder mutation in North but not in South Sardinia.
17636424 PTEN germline mutations are rare
17636424 Observational study of genotype prevalence. (HuGE Navigator)
17636423 families appear to exhibit features most consistent with BRCA1 and BRCA2 carrier status
17636422 The researchers found 17 pathogenic changes in the BRCA2 genes in 64 families with a pedigree of male breast neoplasms.
17635951 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17634561 Observational study of gene-disease association. (HuGE Navigator)
17634561 Mutations found in a significant proportion of women with ductal carcinoma in situ who presented for hereditary risk assessment.
17627006 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17625228 High-risk patients with BRCA1-negative tumors should be screened first for BRCA2 gene.
17625123 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17624602 Observational study of genotype prevalence. (HuGE Navigator)
17603881 Observational study of genetic testing. (HuGE Navigator)
17603793 XRCC1 down-regulation in HeLa cells leads to a decrease in the DNA ligase 3 protein level, significantly increased sensitivity to alkylating agents, elevated level of sister chromatid exchange and decrease in the survival of BRCA2-deficient cells.
17592676 Observational study of gene-disease association. (HuGE Navigator)
17591843 review of some of the most well-known and significant examples of founder mutations in BRCA genes found in European and non-European populations [review]
17591842 Observational study of genetic testing. (HuGE Navigator)
17582599 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17582599 BRCA2 mutation carriers without cancer had increased breaks as well as breaks and gaps per cell
17565157 Observational study of gene-disease association. (HuGE Navigator)
17565157 the Icelandic BRCA2 999del5 founder mutation was strongly associated with rapidly progressing lethal prostate cancer
17549625 BRCA2 c.9079 G>A is not a predisposing variant for early onset breast cancer
17549502 The output 3D molecular structure from the combination between BRCA2-RAD51 is derived
17541404 BRCA2 is a universal regulator of RAD51/DMC1 recombinase actions
17515904 Interactions of the BRCA2 C-terminal region with RAD51 may facilitate efficient nucleation of RAD51 multimers on DNA and thereby stimulate recombination-mediated repair.
17515903 Productive recombination results from the functional balance between the different RAD51-binding modes of the BRC repeat and exon 27 regions of BRCA2.
17503080 Observational study of genotype prevalence. (HuGE Navigator)
17503080 Novel germline mutations in BRCA2 gene is associated with hereditary breast and breast-ovarian cancer
17497966 among carriers of BRCA1 or BRCA2 mutations, the cumulative lifetime risk of developing breast cancer is 50-60% and the equivalent risk of ovarian cancer is 20-40% in Australian women
17471561 Regular surveillance in women at increased familial risk of breast cancer is associated with a good outcome if they carry BRCA2 mutations
17470134 presence of BRCA1 and BRCA2 rearrangements among Asian patients with early onset or familial history of breast or ovarian cancer
17453335 a total of 287 Greek breast/ovarian cancer families, 46 and 13 carry a deleterious mutation in BRCA1 and BRCA2, respectively.
17453335 Observational study of genotype prevalence. (HuGE Navigator)
17445839 the genomic instability observed in normal cells from BRCA1 and BRCA2 mutation carriers is associated with a down-regulation of nuclear BRCA1 protein accumulation in dot like structures
17428325 Observational study of gene-disease association. (HuGE Navigator)
17428325 common polymorphisms in the ATM, BRCA1, BRCA2, CHEK2 and TP53 cancer susceptibility genes are not shown to increase breast cancer risk
17428320 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17426707 unlikely that annual screening will reduce mortality from ovarian cancer in BRCA1/2 mutation carriers.
17416853 Meta-analysis of gene-disease association. (HuGE Navigator)
17413421 Observational study of genetic testing. (HuGE Navigator)
17409195 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17397054 Observational study of genetic testing. (HuGE Navigator)
17386038 Borderline ovarian tumors are neither part of the BRCA1- nor the BRCA2- related tumor spectrum.
17380889 Observational study of genotype prevalence. (HuGE Navigator)
17341484 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17333477 Observational study of genotype prevalence. (HuGE Navigator)
17333343 Our findings suggest that in Central Sudan BRCA1/2 represent an important etiological factor of breast cancer in males and young women less exposed to pregnancy and lactation.
17333342 Observational study of genotype prevalence. (HuGE Navigator)
17333342 BRCA2 genomic rearrangements is associated with breast and ovarian cancer
17333338 Observational study of gene-disease association. (HuGE Navigator)
17324252 substantial levels of aberrant methylation, in the fluid from the breasts of healthy BRCA mutation carriers
17307836 Observational study of gene-disease association. (HuGE Navigator)
17301269 Observational study of genotype prevalence. (HuGE Navigator)
17289875 Observational study of gene-disease association. (HuGE Navigator)
17289875 no evidence was found in this study for an association between BRCA2 mutations and susceptibility to hereditary prostate cancer in men selected from high-risk families
17289874 low mRNA and protein expression in the BRCA1/BRCA2 and XRCC5 genes occur in lung adenocarcinoma and squamous cell carcinoma, respectively, and promoter hypermethylation is the predominant mechanism in deregulation of these genes
17286961 Results implicate BRCA2 in the regulation of the centrosome cycle and provide new insight into the aneuploid nature of many breast cancers.
17285126 Observational study of genetic testing. (HuGE Navigator)
17262179 Observational study of genotype prevalence. (HuGE Navigator)
17262179 BRCA2 mutations are associated with breast ans ovarian cancer
17257844 investigation of the contribution of BRCA-1 and BRCA-2 germline mutations to the clinical features and outcome in 66 Italian women with early-onset breast cancer
17250666 Observational study of genotype prevalence. (HuGE Navigator)
17217814 Observational study of gene-disease association. (HuGE Navigator)
17216544 A novel BRCA2 frame-shift mutation, 3951del3insAT, which produces a protein truncated at codon 1258, was observed in six patients with BC from the same village in Sardinia.
17210933 Observational study of gene-disease association. (HuGE Navigator)
17196508 Observational study of gene-disease association. (HuGE Navigator)
17160431 Observational study of gene-disease association. (HuGE Navigator)
17160431 These data suggest that BRCA2 mutation carriers with ovarian cancer may have better survival than BRCA1 carriers and non-carriers.
17151928 Observational study of gene-disease association. (HuGE Navigator)
17148771 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17148771 BRCA1 and BRCA2 mutations may be more frequent in general populations than previously thought and may be associated with various types of cancers.
17145825 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17145824 Observational study of gene-disease association. (HuGE Navigator)
17119064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17113724 Observational study of genotype prevalence. (HuGE Navigator)
17113724 Large genomic BRCA2 rearrangements were not found among our 36 Finnish male breast cancer patients
17101782 These results identify a novel role for FoxM1 in the transcriptional response during DNA damage/checkpoint signaling and show a novel mechanism by which Chk2 protein regulates expression of DNA repair enzymes.
17100994 Observational study of genotype prevalence. (HuGE Navigator)
17080309 findings show that BRCA mutations account for a substantial proportion of hereditary breast/ovarian cancer in Colombia
17063270 Observational study of genotype prevalence. (HuGE Navigator)
17063270 analysis of BRCA1 and BRCA2 mutations in breast cancer patients from Brazil
17063265 BRCA1 and BRCA2 mutation status have roles in inter-cell-line phenotypic variability after irradiation of lymphoblastoid cell lines
17061047 Observational study of gene-disease association. (HuGE Navigator)
17021353 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17020472 The 5164del4 BRCA2 mutation is not likely to be a founder mutation in non-Ashkenazi Jewish families with high risk of breast and ovarian cancer.
17018785 Observational study of gene-disease association. (HuGE Navigator)
17018160 Observational study of genotype prevalence. (HuGE Navigator)
17018160 BRCA2 mutations appear to account for a lower proportion of breast cancer patients at increased risk of harboring such mutations in Northern India
17010055 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17000754 Tumor cells having disruptions in BRCA1/2 network genes and TP53 together are more sensitive to cisplatin than cells with either disruption alone.
16998791 Observational study of genotype prevalence. (HuGE Navigator)
16998791 Findings show that BRCA2 mutations account for a substantial proportion of hereditary breast/ovarian cancer and early-onset breast and ovarian cancer cases in Pakistan.
16998498 Breast cancers arising in BRCA1 and BRCA2 mutation carriers appear to have specific pathological and gene expression profiles, which show a high level of concordance.BRCA2 overexpress some DNA repair. [REVIEW]
16998496 Effective strategies have been developed to reduce the risk for the development of breast and ovarian cancer in women with BRCA1/2 mutations, making genetic testing for these mutations an important part of the management. [REview]
16956909 Observational study of gene-disease association. (HuGE Navigator)
16950820 Novel and distinct BRCA2 deletions were detected in three families and their boundaries were determined.
16949048 analysis of BRCA1 and BRCA2 mutations from Korean breast cancer patients using denaturing HPLC
16944270 Ninteen percent of the women who developed both invasive breast and ovarian tumors carried one of the analyzed BRCA1 gene mutations but none of the women were positive for the analyzed BRCA2 mutation.
16931905 Observational study of gene-disease association. (HuGE Navigator)
16914443 Human BRCA2 has multiple BRC repeats, motifs of approximately 30 residues, that associate in a ternary complex with RAD51 on single-stranded DNA and double-stranded DNA.
16912212 Observational study of genotype prevalence. (HuGE Navigator)
16912212 Prevalence of BRCA2 mutations in breast cancer cases among racial and age groups and show key predictors of carrier status for both White and Black women and women.
16905680 Testing strategy with an initial test using a panel of reported recurrent mutations, followed by full sequencing predicts prevalence of breast and ovarian cancer.
16886281 BRCA2 mutation may have a role in developing hematologic malignancy
16860930 Results suggest that breast tumours with mutations in BRCA2 or TP53 could be promising candidates for Aurora-A targeted treatment.
16847550 Identification of 13 novel variants including two deleterious truncating mutations and two potentially pathogenic missense mutations on the BRCA1 and BRCA2 genes
16845393 BRCA2 participates in repair of replication-mediated double-strand breaks generated when replication forks encounter interstrand cross-link
16843109 The objective in this study was to determine the frequency of large genomic rearrangements in BRCA1 and BRCA2 in a large group of Danish families with increased risk of breast and ovarian cancer.
16826315 Study identified a specific spectrum of germline BRCA1/BRCA2 mutations in Portuguese families with inherited predisposition to breast/ovarian cancer and found evidence for genetic anticipation regarding age of diagnosis in succeeding generations.
16825431 The small group of patients with biallelic mutations in BRCA2 is distinctive in the severity of the phenotype, and early onset and high rates of leukaemia and specific solid tumours, and may comprise an extreme variant of Fanconi anaemia.
16793542 PALB2 colocalizes with BRCA2 in nuclear foci, promotes its localization and stability in key nuclear structures (e.g., chromatin and nuclear matrix), and enables its recombinational repair and checkpoint functions
16792514 Missense mutation in exon 13 in BRCA2, c.7235G>A, results in skipping of exon 13.
16792513 No BRCA1/2 genomic rearrangements found in high-risk French-Canadian breast/ovarian cancer families.
16783967 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16769276 Observational study of genotype prevalence. (HuGE Navigator)
16769276 BRCA2 mutation is common (9%) among unselected young breast cancer patients undergoing BCT.
16764716 two recurrent BRCA2 mutations predisposing to male breast cancer may facilitate the analyses aimed at the identification of mutation carriers in our geographic area
16760289 Analysis resulted in the identification of 25 and 52 variants in the BRCA1 and BRCA2 genes, respectively in breast or ovarian cancer.
16741161 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16731627 These results provide insight into the recently discovered diversity of BRCA2 domain structures in different organisms.
16728435 Observational study of gene-disease association. (HuGE Navigator)
16724273 Women who had developed breast cancer under the age of 40 and who were identified as BRCA1 or BRCA2 mutation carriers experienced devastation, loneliness and isolation.
16724247 Observational study of genetic testing. (HuGE Navigator)
16701105 Carrier of mutant BRCA2 gene undergoes prophylactic mastectomy.
16648044 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16644204 Observational study of gene-disease association. (HuGE Navigator)
16638864 Observational study of gene-disease association. (HuGE Navigator)
16622123 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16621732 FANCG-XRCC3 and FANCG-BRCA2 interactions did not require the presence of other FA proteins from the core complex
16619214 The effects of BRCA2 intron variants on mRNA splicing and expression.
16574953 Observational study of gene-disease association. (HuGE Navigator)
16574953 Preeminent associations were identified in SNPs mapping to genes pivotal in the DNA damage-response and cell-cycle pathways, including ATM F858L and P1054R, CHEK2 I157T, BRCA2 N372H, and BUB1B Q349R.
16563180 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16563180 Carrying a BRCA1 or BRCA2 mutation is not a risk factor for spontaneous abortions but may be associated with frequency of induced abortion.
16541324 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16539696 Observational study of genotype prevalence. (HuGE Navigator)
16539696 Recurrent BRCA2 mutations in French Canadian breast and/ovarian cancer families could be attributed to common founders.
16537453 Observational study of gene-disease association. (HuGE Navigator)
16485136 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16484695 Observational study of gene-disease association. (HuGE Navigator)
16456781 Observational study of genotype prevalence. (HuGE Navigator)
16455195 Observational study of genotype prevalence. (HuGE Navigator)
16450717 Salpingo-oophorectomy, despite being quite a radical preventive method, might offer protection for the carriers against life-threatening silently-developing cancer.
16419081 there is a decrease in p53 apoptotic rate associated with the No Ins-72Pro haplotype in BRCA2 mutation carriers
16418514 Observational study of genotype prevalence. (HuGE Navigator)
16417627 the data are not compatible with selective pressures during tumorigenesis promoting the functional loss of BRCA2 and MRE11 in microsatellite unstable tumors, but fit closely with an absence of selective pressures acting on BRCA2 and MRE11 gene status
16389418 Observational study of genotype prevalence. (HuGE Navigator)
16369438 The data suggest applying an increased level of clinical alertness to those with defects in BRCA-related pathways.
16331614 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16324400 Observational study of genotype prevalence. (HuGE Navigator)
16284991 Observational study of genotype prevalence. (HuGE Navigator)
16284991 The frequency of hereditary ovarian carcinoma is attributed to BRCA2 gene mutation.
16280055 Observational study of gene-disease association. (HuGE Navigator)
16271956 Observational study of genotype prevalence. (HuGE Navigator)
16261408 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16261408 the Met1915Thr polymorphism in the BRCA2 gene may be considered as an independent marker of breast cancer
16261400 BRCA2 mutations are associated with breast and ovarian cancer
16257105 Observational study of gene-disease association. (HuGE Navigator)
16257105 results of this study suggested that the polymorphism N372H in BRCA2 gene may be associated with idiopathic male infertility with azoospermia or severe oligozoospermia
16234515 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16214912 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16199546 large genomic deletions inactivate the BRCA2 gene in breast cancer families
16176503 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16168130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16168130 Weight loss in early adult life (age 18 to 30) protects against early-onset BRCA2 associated breast cancers.
16168123 Conclusive evidence that the S384F variant of BRCA2 is not a disease causing mutation in breast cancer.
16168118 Mutational analysis of BRCA1/2 genes in 151 high-risk patients characterized the spectrum of gene alterations and demonstrated the dominant role of the BRCA1 c.5266dupC allele in hereditary breast and ovarian cancer.
16140006 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16137751 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16118051 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16088935 analysis of Alu element insertions within the BRCA1/2 coding sequences
16049805 Observational study of gene-environment interaction. (HuGE Navigator)
16047333 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16042582 ells lacking the fully functional protein have consistently been found to show increased sensitivity to a variety of DNA-damaging agents.
16032702 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16030099 Observational study of genotype prevalence. (HuGE Navigator)
16029503 Observational study of gene-disease association. (HuGE Navigator)
16003728 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15996267 Observational study of gene-disease association. (HuGE Navigator)
15994883 Meta-analysis of gene-disease association. (HuGE Navigator)
15986445 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15986445 women with a BRCA1 protein mutation and 4 or more children had a 38% decrease in breast cancer risk compared to nulliparous women, while among BRCA2 protein carriers, increasing parity was associated with an increased risk of breast cancer
15983021 Observational study of genotype prevalence. (HuGE Navigator)
15983021 Distribution of BRCA1 and BRCA2 mutations in a cohort of young women with breast cancer, compared as a function with race.
15978801 Observational study of gene-disease association. (HuGE Navigator)
15937124 BRCA2 BRC motifs bind distinct regions, and form stable complexes with RAD51-DNA nucleoprotein filaments.
15936476 Germline mutations within breast cancer susceptibility genes, such as BRCA1 and BRCA2 are associated with a major risk of breast cancer during lifetime.
15930334 Observational study of gene-disease association. (HuGE Navigator)
15930293 Expression of BRCA2 and MAGE-D1 synergistically suppresses cell proliferation independently of the p53 pathway.
15917310 role of BRCA1 and BRCA2 mutation in pre-disposition to ovarian cancer.
15900600 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15900600 There is no significant effect of AIB1 genetic variation on breast cancer risk in BRCA2 mutation carriers.
15894703 No association was found for the N372H polymorphism in BRCA2 and breast cancer among Caucasian women.
15887246 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
15887246 BRCA1/2 mutation screening should be considered for all women diagnosed before age 41.
15880530 Observational study of gene-disease association. (HuGE Navigator)
15863145 Observational study of gene-environment interaction. (HuGE Navigator)
15806175 Observational study of gene-disease association. (HuGE Navigator)
15800615 results indicate that S3291 phosphorylation might provide a molecular switch to regulate RAD51 recombination activity, providing new insight into why BRCA2 C-terminal deletions lead to radiation sensitivity and cancer predisposition
15800311 Observational study of genetic testing. (HuGE Navigator)
15734957 Observational study of gene-disease association. (HuGE Navigator)
15734731 SLUG is a negative regulator for BRCA2 gene expression
15733268 Observational study of gene-disease association. (HuGE Navigator)
15733268 results reveal unique characteristics of BRCA1/2 mutation, genotype-phenotype & prognosis in moderate- & low-risk individuals of Greek ancestry; breast cancer due to mutations in BRCA1 & BRCA2 appears to be a heterogeneous syndrome in Greek population
15728167 Observational study of gene-disease association. (HuGE Navigator)
15726604 Observational study of genotype prevalence. (HuGE Navigator)
15721786 Identification of a potential novel domain in the BRCA2 protein.
15671039 FANCD2 mediates double strand DNA break repair independently of BRCA2- and Rad51-associated homologous recombination
15670748 Quantitative-PCR and Northern analysis confirmed down-regulation of UCRP and UBE2L6 with BRCA2 knockdown, respectively.
15635067 prevalence of BRCA2 mutations in a large hospital based series of unselected breast cancer cases
15617999 Observational study of gene-disease association. (HuGE Navigator)
15589605 Observational study of gene-disease association. (HuGE Navigator)
15576832 Observational study of gene-disease association. (HuGE Navigator)
15571962 Observational study of genotype prevalence. (HuGE Navigator)
15564800 Observational study of gene-disease association. (HuGE Navigator)
15559734 Observational study of healthcare-related. (HuGE Navigator)
15548363 Observational study of genotype prevalence. (HuGE Navigator)
15545966 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15519522 Observational study of gene-environment interaction. (HuGE Navigator)
15375219 results show that BRCA2 deficiency impairs the completion of cell division by cytokinesis
15367553 Observational study of genetic testing. (HuGE Navigator)
15365993 Observational study of genotype prevalence. (HuGE Navigator)
15365993 A novel pathogenic germline mutations,BRCA2 c.2259delT, was found in a screening of sporadic Korean breast cancer patients, along with 4 polymorphic and 8 intronic variants of unknown clinical significance.
15345109 Observational study of genotype prevalence. (HuGE Navigator)
15331870 Observational study of healthcare-related. (HuGE Navigator)
15319244 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15319244 Patients with bilateral breast cancer having BRCA2 mutations are significantly younger than non-carriers.
15317758 Observational study of gene-disease association. (HuGE Navigator)
15314155 Results suggest that BRCA2 expression levels are regulated by ubiquitination in response to DNA damage and that USP11 participates in DNA damage repair functions within the BRCA2 pathway independently of BRCA2 deubiquitination.
15284715 Observational study of healthcare-related. (HuGE Navigator)
15280342 Observational study of gene-disease association. (HuGE Navigator)
15280188 Observational study of healthcare-related. (HuGE Navigator)
15265971 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15254695 BRCA2 germline mutations may have a role in primary cancer of the fallopian tube
15236312 Observational study of gene-disease association. (HuGE Navigator)
15217508 Observational study of gene-environment interaction. (HuGE Navigator)
15199141 results demonstrate that monoubiquitination of FANCD2, which is regulated by the FA pathway, promotes BRCA2 loading into chromatin complexes. These complexes appear to be required for normal homology-directed DNA repair.
15170666 RAD51D polymorphism is not associated with BRCA1 or 2 genes in breast cancer.
15168169 Identification and evaluation of 55 genetic variations in the BRCA1 and the BRCA2 genes of patients from 50 Japanese breast cancer families
15159322 Observational study of healthcare-related. (HuGE Navigator)
15144764 Observational study of healthcare-related. (HuGE Navigator)
15140371 Observational study of healthcare-related. (HuGE Navigator)
15140370 Observational study of healthcare-related. (HuGE Navigator)
15138485 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15138483 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15131403 Observational study of genetic testing. (HuGE Navigator)
15131400 Observational study of genotype prevalence. (HuGE Navigator)
15131400 BRCA2 mutations could not be detected among unrelated non-Ashkenazi-Jewish high risk families in Israel.
15131399 Cancer variation associated with the position of the mutation in the BRCA2 gene in 7 different neoplasms and the differences in cancer risk remain to be explored.
15131025 Observational study of gene-disease association. (HuGE Navigator)
15117986 Observational study of gene-disease association. (HuGE Navigator)
15116316 Observational study of gene-disease association. (HuGE Navigator)
15115758 FANCD2 and BRCA2 can be coimmunoprecipitated from cell extracts of both human and Chinese hamster wild-type cells, thus confirming that the interaction occurs in vivo
15114373 Observational study of gene-disease association. (HuGE Navigator)
15104281 Our results suggest that there is a field effect of early genetic events preceding morphologic changes in the mammary glands of BRCA mutation carriers.
15095307 Observational study of gene-disease association. (HuGE Navigator)
15086724 Observational study of gene-disease association. (HuGE Navigator)
15084244 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15083174 Observational study of gene-disease association. (HuGE Navigator)
15082902 Observational study of gene-disease association. (HuGE Navigator)
15082902 BRCA mutations were present in 12.7% of the high risk patients, compared with 2.8% of the unselected patients.
15073127 Observational study of gene-disease association. (HuGE Navigator)
15073127 BRCA1 and BRCA2 mutations may have a role in progression of ovarian cancer
15070707 identified 6 children in 5 kindreds exhibiting the co-occurrence of BRCA2 mutations, FA, and early onset acute leukemia
15067026 Observational study of genetic testing. (HuGE Navigator)
15059511 Observational study of gene-disease association. (HuGE Navigator)
15053073 Observational study of gene-disease association. (HuGE Navigator)
15053071 Observational study of gene-disease association. (HuGE Navigator)
15041722 Observational study of gene-disease association. (HuGE Navigator)
15041722 BRCA1-related breast cancers are more frequently estrogen receptor (ER) negative than are either BRCA2-related or nonhereditary breast cancers.
15015609 Allelic loss at the BRCA2 locus may be of use as a negative predictor for metastases-free and overall survival in breast cancer patients.
14984481 Observational study of genetic testing. (HuGE Navigator)
14973102 Observational study of gene-disease association. (HuGE Navigator)
14769635 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
14761918 Observational study of gene-disease association. (HuGE Navigator)
14755459 Observational study of genetic testing. (HuGE Navigator)
14752193 Man with a history of clinically diagnosed right breast cancer who subsequently tested positive for the breast cancer susceptibility gene BRCA2 and received a diagnosis of mammographically detected left breast cancer at screening.
14746861 Observational study of gene-disease association. (HuGE Navigator)
14735581 Observational study of genetic testing. (HuGE Navigator)
14735173 Observational study of genetic testing. (HuGE Navigator)
14732925 Observational study of gene-disease association. (HuGE Navigator)
14732925 heterozygosity for germ-line mutations in BRCA2 results in development of progesterone receptor A predominance.
14722926 Observational study of genotype prevalence. (HuGE Navigator)
14722926 Novel germline deleterious pathogenic, protein truncating frameshift and non-sense mutations were detected in exon 11 of BRCA2 in breast-ovarian cancer families.
14709740 Observational study of gene-disease association. (HuGE Navigator)
14709734 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14680495 Observational study of gene-disease association. (HuGE Navigator)
14678969 Observational study of gene-disease association. (HuGE Navigator)
14673037 Observational study of gene-disease association. (HuGE Navigator)
14670928 Molecular analysis revealed biallelic BRCA2/FANCD1 mutations in a kindred with solid tumors in childhood.
14668548 Observational study of gene-disease association. (HuGE Navigator)
14662532 Observational study of genetic testing. (HuGE Navigator)
14660434 In transgenic mice, rescues embryonic lethality and mice develop normally.
14651845 The remarkable clinical overlap between sporadic EMSY amplification and familial BRCA2 deletion implicates a BRCA2 pathway in sporadic breast and ovarian cancer.
14648706 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14647438 Observational study of gene-disease association. (HuGE Navigator)
14647438 fiver germline mutations in cases of familial esophageal squamous cell carcinoma suggests role in genetic susceptibility
14647419 inactivation of the FANC-BRCA pathway is relatively common in solid tumors and may be related to tobacco and alcohol exposure
14647210 Observational study of gene-disease association. (HuGE Navigator)
14636569 Data report the isolation of a holoenzyme complex termed BRCC containing BRCA1, BRCA2, and RAD51, which displays increased association with p53 following DNA damage and ubiquitinates p53 in vitro.
14615451 Observational study of gene-disease association. (HuGE Navigator)
14586320 Observational study of healthcare-related. (HuGE Navigator)
14581427 Observational study of healthcare-related. (HuGE Navigator)
14580256 Observational study of genetic testing. (HuGE Navigator)
14580253 Observational study of genetic testing. (HuGE Navigator)
14576434 Observational study of gene-disease association. (HuGE Navigator)
14576434 risks of breast and ovarian cancer were determined for Ashkenazi Jewish women with inherited mutations in the tumor suppressor genes BRCA1 and BRCA2
14574155 BRCA2 mutation is associated with serous carcinoma of ovary
14572939 Observational study of healthcare-related. (HuGE Navigator)
14555518 Observational study of gene-disease association. (HuGE Navigator)
14555511 Observational study of gene-disease association. (HuGE Navigator)
14519755 Observational study of gene-disease association. (HuGE Navigator)
14517958 Observational study of gene-disease association. (HuGE Navigator)
14507240 Observational study of gene-disease association. (HuGE Navigator)
14507240 study from South India, on BRCA1, BRCA2 & CHEK2 mutations in patients with a family history of breast and/or ovarian cancer and early onset breast/ovarian cancer
12967657 BRCA2 is epistatic to FA genes for ICL repair, but not for damage-induced modification of FANCD2 and may act downstream form FANCD2.
12946038 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12946038 In general, OC use, childbearing and breastfeeding do not differ between BRCA1/2 carriers and non-carriers with ovarian cancer. However, the effects of tubal ligation may differ between BRCA1 carriers and non-carriers.
12942367 Observational study of genotype prevalence. (HuGE Navigator)
12942367 the spectrum of BRCA2 mutations in African Americans
12938098 Eight novel BRCA2 mutations identified in breast and ovarian cancers may be deleterious cancer predisposing mutations.
12937835 Observational study of genetic testing. (HuGE Navigator)
12927042 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12927042 The product of the BRCA2 gene has a function relating to the differentiation of epithelial tissue in the breast in response to the hormones of pregnancy.
12920090 Recurrent BRCA2 mutations have no role in predisposition to prostate cancer in Finland.
12917199 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12911837 Observational study of gene-disease association. (HuGE Navigator)
12911720 Observational study of gene-disease association. (HuGE Navigator)
12911720 None of the BRCA 1 or 2 mutations were detected in the ovarian cancer patient group.
12883740 Observational study of gene-disease association. (HuGE Navigator)
12879478 Observational study of genotype prevalence. (HuGE Navigator)
12865453 Observational study of gene-disease association. (HuGE Navigator)
12845657 Observational study of gene-disease association. (HuGE Navigator)
12833555 Observational study of genetic testing. (HuGE Navigator)
12815053 BRCA2 has a role in modulating M phase progression
12798717 Observational study of gene-disease association. (HuGE Navigator)
12779088 Androgen receptor expression is absent in BRCA1-mutated breast tumors when compared to BRCA2-mutated cases, indicating that BRCA2-mutated tumors may be different.
12774040 Observational study of gene-disease association. (HuGE Navigator)
12771943 major role of Brca2 in mediating cell survival after irradiation is in the S and G(2) phases of the cell cycle
12756300 wild-type BRCA2, but not a tumor-specific truncated mutant BRCA2, synergizes with the nuclear receptor coactivator p160 GRIP1 to enhance transcriptional activation by androgen receptor
12712470 Observational study of gene-disease association. (HuGE Navigator)
12704633 Observational study of genetic testing. (HuGE Navigator)
12698193 Founder mutations are present within the Scottish/Northern Irish population and have implications for the organisation of molecular screening services.
12691152 Observational study of gene-disease association. (HuGE Navigator)
12691152 germline BRCA2 mutations are not associated with an increased risk for lymphoid malignancies
12684407 Observational study of gene-disease association. (HuGE Navigator)
12677558 Meta-analysis of gene-disease association. (HuGE Navigator)
12677558 Average cumulative risks in BRCA2-mutation carriers by age 70 years were 45% (95% confidence interval 31%-56%) for breast cancer and 11% (2.4%-19%) for ovarian cancer
12673354 Changes in the topoisomerase I activity in V-C8 cells are due to the defective function of the Brca2 gene.
12672886 Observational study of genetic testing. (HuGE Navigator)
12670525 Observational study of gene-disease association. (HuGE Navigator)
12670525 polymorphisms in BRCA2 is associated with esophageal squamous cell carcinoma
12655567 Observational study of genotype prevalence. (HuGE Navigator)
12655560 Observational study of genotype prevalence. (HuGE Navigator)
12644778 Observational study of genetic testing. (HuGE Navigator)
12644538 Observational study of gene-disease association. (HuGE Navigator)
12618335 BRCA2 germline mutation is associated with fallopian tube cancer.
12611452 Observational study of gene-disease association. (HuGE Navigator)
12606939 S-phase RAD51 foci form normally in CAPAN-1 cells expressing truncated BRCA2. The observed BRCA2-dependent & independent formation of RAD51 foci shows that intact BRCA2 is not required for RAD51 focus formation per se.
12569143 Our data support an important role for BRCA2 germline mutations in a subpopulation of families with familial pancreatic cancer.
12568865 mutation analysis of this gene in a case of familial endometriosis
12567413 Observational study of genetic testing. (HuGE Navigator)
12556369 Observational study of genotype prevalence. (HuGE Navigator)
12552570 The BRCA2 gene plays a significant role in the familial breast cancer phenotype in the Cypriot population.
12543786 Observational study of gene-disease association. (HuGE Navigator)
12527904 cancer-predisposing mutation compromises interaction between BRCA2 and replication protein A
12504628 Observational study of genotype prevalence. (HuGE Navigator)
12496047 Observational study of genetic testing. (HuGE Navigator)
12491828 Observational study of genotype prevalence. (HuGE Navigator)
12485194 Observational study of genetic testing. (HuGE Navigator)
12484126 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12476445 Observational study of genetic testing. (HuGE Navigator)
12474142 Observational study of gene-disease association. (HuGE Navigator)
12473589 Observational study of gene-disease association. (HuGE Navigator)
12471628 Observational study of gene-disease association. (HuGE Navigator)
12470990 BRCA2 has a more specific role in DNA repair, regulating the activity of RAD51(review)
12464649 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12461697 highly recurrent BRCA2 splice site mutation (IVS16-2A>G) in three breast cancer-only families
12457999 Observational study of genotype prevalence. (HuGE Navigator)
12453858 Germline mutations in BRCA2 account for breast neoplasms predisposition in the majority of families.
12442275 BRCA2 2663-2664insA and rare variants were identified in breast cancer patients in Mexico.
12442274 BRCA2 mutation, 7883delTTAA, was identified in breast cancer patients in China.
12442273 Two BRCA2 missense variants were identified in breast cancer patients in India.
12442171 crystal structure of a complex between an evolutionarily conserved sequence in BRCA2 (the BRC repeat) and the RecA-homology domain of RAD51
12440810 BBRCA2 gene mutation in unselected women with ovarian and early breast cancer in Mongolia predicts the genetic predisoposition to these diseases.
12433008 Observational study of genetic testing. (HuGE Navigator)
12431973 Observational study of genetic testing. (HuGE Navigator)
12404104 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12385017 Observational study of gene-disease association. (HuGE Navigator)
12376518 Observational study of genetic testing. (HuGE Navigator)
12376208 Observational study of genetic testing. (HuGE Navigator)
12242698 recent findings regarding BRCA2 in breast cancer - review
12237897 Survival in prospectively ascertained familial breast cancer: analysis of a series stratified by tumour characteristics, BRCA mutations and oophorectomy
12237285 inactivated in ovarian cancer
12229876 Observational study of genetic testing. (HuGE Navigator)
12229875 relation of gene to various cancers, especially breast and ovarian cancers
12228710 crystal structure of a COOH terminal BRCA2 domain bound to DSS1; demonstrate that this BRCA2 domain binds single-stranded DNA and show that BRCA2 stimulates RAD51-mediated recombination in vitro
12220452 Observational study of gene-disease association. (HuGE Navigator)
12215251 eight of the most common reported missense mutations in BRCA1 and BRCA2 occurring in patients tested for hereditary risk of breast and ovarian cancers
12210341 Observational study of genetic testing. (HuGE Navigator)
12181777 Observational study of gene-disease association. (HuGE Navigator)
12181777 Contribution of BRCA1 and BRCA2 mutations to breast and ovarian cancer in Pakistan.
12145750 first BRCA2 missense mutation shown to be a predicted deleterious protein-truncating mutation and suggests a potentially useful method for determining the clinical significance of a subset of the many unclassified variants in BRCA1 and BRCA2
12125210 Observational study of genotype prevalence. (HuGE Navigator)
12114473 The 999del5 mutation in the BRCA2 gene explains a substantial proportion of familial risk of breast cancer in Iceland.
12112655 Observational study of gene-disease association. (HuGE Navigator)
12112655 Results demonstrate the importance of BRCA2 in the development of ovarian cancer in this Turkish population.
12101561 Observational study of genotype prevalence. (HuGE Navigator)
12100744 Observational study of genotype prevalence. (HuGE Navigator)
12100744 BRCA2 exons 10 & 11 were studied by the protein truncation test, & BRCA2 exons 9, 17, 18 and 23 with the SSCP assay on genomic DNA from early-onset breast cancer patients by PCR. 2 frameshifts, 3 missense mutations, and a polymorphism were found.
12088120 Observational study of genetic testing. (HuGE Navigator)
12070551 Observational study of gene-disease association. (HuGE Navigator)
12065746 cell lines derived from Fanconi anemia B and D1 patients have biallelic mutations in BRCA2 and express truncated BRCA2 proteins
12039933 Observational study of genetic testing. (HuGE Navigator)
12036913 Observational study of gene-disease association. (HuGE Navigator)
12023992 Observational study of genetic testing. (HuGE Navigator)
12020440 Observational study of gene-disease association. (HuGE Navigator)
12020440 Cells from carriers of mutations in one allele of the BRCA1 or BRCA2 genes have no gross defects in their ability to rejoin radiation-induced DNA breaks.
11983207 Expression of BRCA1 and BRCA2 in different tumor cell lines with various growth status
11981002 Observational study of gene-disease association. (HuGE Navigator)
11977534 Observational study of genetic testing. (HuGE Navigator)
11972384 Observational study of genotype prevalence. (HuGE Navigator)
11964925 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11953874 Observational study of genetic testing. (HuGE Navigator)
11950811 Observational study of gene-disease association. (HuGE Navigator)
11948477 somatic mutations in BRCA2 and high frequency of allelic loss occurs in sporadic male breast cancer
11927503 Observational study of gene-disease association. (HuGE Navigator)
11927503 BRCA2 N372H polymorphism associated with modest recessively inherited risk of breast cancer in Australian women
11920621 Observational study of gene-disease association. (HuGE Navigator)
11920551 Observational study of genetic testing. (HuGE Navigator)
11897832 Contribution of BRCA2 germline mutations to hereditary breast/ovarian cancer in Germany.
11896095 Observational study of genotype prevalence. (HuGE Navigator)
11890937 Observational study of gene-disease association. (HuGE Navigator)
11890937 mutagen sensitivity of blood lymphocytes from women carrying brca2 mutatioon
11883440 minor role of exon 1 among Sudanesse breast cancer patients
11879560 Observational study of genotype prevalence. (HuGE Navigator)
11873550 Observational study of genetic testing. (HuGE Navigator)
11870509 Observational study of gene-environment interaction. (HuGE Navigator)
11870168 Observational study of genetic testing. (HuGE Navigator)
11857749 Observational study of genotype prevalence. (HuGE Navigator)
11857749 Three Chinese cases carrying the recurrent BRCA2 mutation 3337C>T show sharing of some alleles, suggesting some degree of shared ancestry but not sufficient to demonstrate founder effect.
11857748 A low frequency of recurrent BRCA2 mutations has been found in breast and ovarian cancers in Spain.
11857383 Observational study of genotype prevalence. (HuGE Navigator)
11857015 Observational study of gene-gene interaction. (HuGE Navigator)
11844822 Observational study of genetic testing. (HuGE Navigator)
11822793 Observational study of genetic testing. (HuGE Navigator)
11807889 Observational study of genetic testing. (HuGE Navigator)
11807777 Germline mutation in BRCA2 associated with hypersensitivity to radiation
11802209 Observational study of genotype prevalence. (HuGE Navigator)
11802208 Observational study of genotype prevalence. (HuGE Navigator)
11793480 BRCA1 and BRCA2 mutations in Russian familial breast cancer
11788883 Suppression of tumorigenicity of rat liver tumor cells by human chromosome 13: evidence against the involvement of pRb and BRCA2
11786581 Observational study of genetic testing. (HuGE Navigator)
11786575 Observational study of gene-disease association. (HuGE Navigator)
11754111 Observational study of gene-disease association. (HuGE Navigator)
11710890 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11698567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11668223 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11584901 Observational study of gene-gene interaction. (HuGE Navigator)
11562929 Clinical trial of genetic testing. (HuGE Navigator)
11556836 Observational study of gene-disease association. (HuGE Navigator)
11550168 Observational study of genetic testing. (HuGE Navigator)
11535547 Observational study of gene-disease association. (HuGE Navigator)
11505617 Observational study of gene-disease association. (HuGE Navigator)
11504767 Observational study of gene-disease association. (HuGE Navigator)
11493753 Observational study of genotype prevalence. (HuGE Navigator)
11481082 Observational study of gene-disease association. (HuGE Navigator)
11474660 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11466700 Observational study of genotype prevalence. (HuGE Navigator)
11448436 Observational study of genetic testing. (HuGE Navigator)
11437399 Observational study of gene-disease association. (HuGE Navigator)
11433401 Observational study of genetic testing. (HuGE Navigator)
11426450 Observational study of genetic testing. (HuGE Navigator)
11410514 Observational study of genetic testing. (HuGE Navigator)
11403219 Observational study of genetic testing. (HuGE Navigator)
11377596 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11263938 Observational study of gene-disease association. (HuGE Navigator)
11248061 Observational study of gene-gene interaction. (HuGE Navigator)
11221880 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11207041 Observational study of gene-disease association. (HuGE Navigator)
11207040 Observational study of gene-disease association. (HuGE Navigator)
11192759 Observational study of genetic testing. (HuGE Navigator)
11181654 Observational study of gene-disease association. (HuGE Navigator)
11180449 Observational study of genotype prevalence. (HuGE Navigator)
11149425 Observational study of genotype prevalence. (HuGE Navigator)
11130383 Observational study of gene-environment interaction. (HuGE Navigator)
11097234 Observational study of genetic testing. (HuGE Navigator)
11073541 Observational study of genetic testing. (HuGE Navigator)
11063672 Observational study of genetic testing. (HuGE Navigator)
11062481 Observational study of gene-disease association. (HuGE Navigator)
11044354 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPS      1 - 70
YNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLS     71 - 140
ESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI    141 - 210
VRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCK    211 - 280
DHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKE    281 - 350
KYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD    351 - 420
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISG    421 - 490
TSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDN    491 - 560
GSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANAFEAPLT    561 - 630
FANADSGLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQL    631 - 700
FITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLI    701 - 770
LTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM    771 - 840
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNNLALGNTKELH    841 - 910
ETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNID    911 - 980
KIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNT    981 - 1050
LALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEE   1051 - 1120
SGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKR   1121 - 1190
KFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL   1191 - 1260
SSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRN   1261 - 1330
SHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACH   1331 - 1400
GNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDI   1401 - 1470
RKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLD   1471 - 1540
KVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETV   1541 - 1610
VPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTS   1611 - 1680
VSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYS   1681 - 1750
YHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPC   1751 - 1820
KNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIM   1821 - 1890
AGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKC   1891 - 1960
SIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREEN   1961 - 2030
TAIRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ   2031 - 2100
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTK   2101 - 2170
VSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDEL   2171 - 2240
TDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQEKSLKASKST   2241 - 2310
PDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGH   2311 - 2380
PFYQVSATRNEKMRHLITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKIN   2381 - 2450
DNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPR   2451 - 2520
ISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPS   2521 - 2590
NDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRY   2591 - 2660
DTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKA   2661 - 2730
QLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRP   2731 - 2800
FPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQ   2801 - 2870
EEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKK   2871 - 2940
QAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYH   2941 - 3010
LATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKFLDPDFQPSCSEVDLIGFVVS   3011 - 3080
VVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASP   3081 - 3150
KEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSP   3151 - 3220
NCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFV   3221 - 3290
SPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEK   3291 - 3360
QFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI               3361 - 3418
//

Text Mined References (1410)

PMID Year Title
27002934 2016 Phase 2 multicentre trial investigating intermittent and continuous dosing schedules of the poly(ADP-ribose) polymerase inhibitor rucaparib in germline BRCA mutation carriers with advanced ovarian and breast cancer.
26997744 2016 Contribution of BRCA1 and BRCA2 Germline Mutations to Early Algerian Breast Cancer.
26989051 2016 Male breast cancer is not congruent with the female disease.
26979245 Polymorphism rs144848 in BRCA2 may reduce lung cancer risk in women: a case-control study in southeast China.
26976601 2016 BRCA2 regulates DMC1-mediated recombination through the BRC repeats.
26888723 2016 Low prevalence of HER2 positivity amongst BRCA1 and BRCA2 mutation carriers and in primary BRCA screens.
26859126 2016 Twenty-one-gene recurrence score assay in BRCA-associated versus sporadic breast cancers: Differences based on germline mutation status.
26857456 2016 Male breast cancer in BRCA1 and BRCA2 mutation carriers: pathology data from the Consortium of Investigators of Modifiers of BRCA1/2.
26852015 2016 Novel germline mutations and unclassified variants of BRCA1 and BRCA2 genes in Chinese women with familial breast/ovarian cancer.
26842001 2016 Fanconi anemia genes in lung adenocarcinoma- a pathway-wide study on cancer susceptibility.
26833090 2016 Non-catalytic Roles for XPG with BRCA1 and BRCA2 in Homologous Recombination and Genome Stability.
26780556 2016 Investigating the effect of 28 BRCA1 and BRCA2 mutations on their related transcribed mRNA.
26775038 2016 Intracellular location of BRCA2 protein expression and prostate cancer progression in the Swedish Watchful Waiting Cohort.
26750490 2016 miR-17-5p promotes the growth of osteosarcoma in a BRCC2-dependent mechanism.
26749359 2016 Cardiac function in BRCA1/2 mutation carriers with history of breast cancer treated with anthracyclines.
26748828 2016 Targeting BRCA1 and BRCA2 Deficiencies with G-Quadruplex-Interacting Compounds.
26745123 2015 Methylation Status and Expression of BRCA2 in Epithelial Ovarian Cancers in Indonesia.
26700119 2016 Impact of Age at Primary Breast Cancer on Contralateral Breast Cancer Risk in BRCA1/2 Mutation Carriers.
26698676 2016 Treatment of infertility does not increase the risk of ovarian cancer among women with a BRCA1 or BRCA2 mutation.
26638190 2016 Screening for familial and hereditary prostate cancer.
26629528 2015 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-?B Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers.
26588056 2015 Risk-reducing surgery in BRCA 1/2 mutation carries: a point of view.
26586665 2016 BRCA2 Polymorphic Stop Codon K3326X and the Risk of Breast, Prostate, and Ovarian Cancers.
26584049 2015 The Fanconi Anemia Pathway Protects Genome Integrity from R-loops.
26577449 2015 BRCA1, BRCA2 and PALB2 mutations and CHEK2 c.1100delC in different South African ethnic groups diagnosed with premenopausal and/or triple negative breast cancer.
26574845 2016 Invasion Patterns of Metastatic Extrauterine High-grade Serous Carcinoma With BRCA Germline Mutation and Correlation With Clinical Outcomes.
26566883 2016 Homozygous missense mutation in the LMAN2L gene segregates with intellectual disability in a large consanguineous Pakistani family.
26543556 2015 Addressing health disparities in Hispanic breast cancer: accurate and inexpensive sequencing of BRCA1 and BRCA2.
26496879 2015 DCIS in BRCA1 and BRCA2 mutation carriers: prevalence, phenotype, and expression of oncodrivers C-MET and HER3.
26496279 2015 BRCA2 N372H Polymorphism and Risk of Epithelial Ovarian Cancer: An Updated Meta-Analysis With 2344 Cases and 9672 Controls.
26489613 2015 Effect of BRCA2 mutation on familial breast cancer survival: A systematic review and meta-analysis.
26483394 2016 Prevalence of Pathogenic Mutations in Cancer Predisposition Genes among Pancreatic Cancer Patients.
26467044 2015 Adjuvant radiotherapy for primary breast cancer in BRCA1 and BRCA2 mutation carriers and risk of contralateral breast cancer with special attention to patients irradiated at younger age.
26467043 2015 Does the age of breast cancer diagnosis in first-degree relatives impact on the risk of breast cancer in BRCA1 and BRCA2 mutation carriers?
26455428 2015 Reevaluation of the BRCA2 truncating allele c.9976A?>?T (p.Lys3326Ter) in a familial breast cancer context.
26439132 2016 BRCA1 and BRCA2 mutations in Japanese patients with ovarian, fallopian tube, and primary peritoneal cancer.
26438354 2016 Uptake of risk-reducing salpingo-oophorectomy among female BRCA mutation carriers: experience at the National Cancer Center of Korea.
26402875 2015 Germline Mutations of BRCA1 and BRCA2 in Korean Ovarian Cancer Patients: Finding Founder Mutations.
26378051 2015 miRNA expression patterns in normal breast tissue and invasive breast cancers of BRCA1 and BRCA2 germ-line mutation carriers.
26347108 2015 High burden of copy number alterations and c-MYC amplification in prostate cancer from BRCA2 germline mutation carriers.
26335130 2015 BRCA mutation carriers show normal ovarian response in in vitro fertilization cycles.
26254840 2016 Screening for Genetic Testing in Breast Cancer - Are We Missing the Full Picture?
26239694 2015 Risk of contralateral breast cancer in BRCA1 and BRCA2 mutation carriers: a 30-year semi-prospective analysis.
26225655 2015 Targeted Resequencing of 30 Genes Improves the Detection of Deleterious Mutations in South Indian Women with Breast and/or Ovarian Cancers.
26219241 2015 Multigene Panel Testing Detects Equal Rates of Pathogenic BRCA1/2 Mutations and has a Higher Diagnostic Yield Compared to Limited BRCA1/2 Analysis Alone in Patients at Risk for Hereditary Breast Cancer.
26195121 2015 Breast cancer risk for Korean women with germline mutations in BRCA1 and BRCA2.
26183948 2015 Spectrum and frequencies of BRCA1/2 mutations in Bulgarian high risk breast cancer patients.
26181175 2015 Effect of Oophorectomy on Survival After Breast Cancer in BRCA1 and BRCA2 Mutation Carriers.
26153499 2015 BRCA1 and BRCA2 genetic testing-pitfalls and recommendations for managing variants of uncertain clinical significance.
26145171 2015 Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.
26111274 2015 Analyze Association of BRCA2 Arg372His Polymorphism With Ovarian Cancer Risk.
26047126 2015 BRCA Mutations Increase Fertility in Families at Hereditary Breast/Ovarian Cancer Risk.
26028024 2016 Breast and ovarian cancer predisposition due to de novo BRCA1 and BRCA2 mutations.
26026974 2015 BRCA1 and BRCA2 mutations in males with familial breast and ovarian cancer syndrome. Results of a Spanish multicenter study.
26006218 2015 Prospective multicenter cohort study of estrogen and insulin-like growth factor system in BRCA mutation carriers.
25980896 2015 Psychological distress related to BRCA testing in ovarian cancer patients.
25971625 2015 Evaluation of BRCA1/2 mutational status among German and Austrian women with triple-negative breast cancer.
25948675 2015 BRCAPRO 6.0 Model Validation in Male Patients Presenting for BRCA Testing.
25948282 2015 New recurrent BRCA1/2 mutations in Polish patients with familial breast/ovarian cancer detected by next generation sequencing.
25940717 2015 Germline BRCA Mutations in a Large Clinic-Based Cohort of Patients With Pancreatic Adenocarcinoma.
25927241 2015 Safeguarding genome stability: RASSF1A tumor suppressor regulates BRCA2 at stalled forks.
25919761 2014 Associations of common breast cancer susceptibility alleles with risk of breast cancer subtypes in BRCA1 and BRCA2 mutation carriers.
25892146 2015 BRCA1 and BRCA2 mutation type associated with cancer risk.
25879355 Expression of BRCA1 and BRCA2 proteins and their correlation with clinical staging in breast cancer.
25869530 2015 BRCA2 variant aerodigestive cancer risk.
25868867 2015 Factors associated with genetic counseling and BRCA testing in a population-based sample of young Black women with breast cancer.
25865228 2015 Autoimmune response to PARP and BRCA1/BRCA2 in cancer.
25863477 2015 The prevalence and spectrum of BRCA1 and BRCA2 mutations in Korean population: recent update of the Korean Hereditary Breast Cancer (KOHBRA) study.
25850293 [Genotyping of BRCA1, BRCA2 and CHEK2 germline mutations in Russian breast cancer patients using diagnostic biochips].
25849179 2015 Association of type and location of BRCA1 and BRCA2 mutations with risk of breast and ovarian cancer.
25838448 2015 A rare truncating BRCA2 variant and genetic susceptibility to upper aerodigestive tract cancer.
25833210 2015 Two PALB2 germline mutations found in both BRCA1+ and BRCAx familial breast cancer.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
25824734 2015 The spectrum of genetic mutations in breast cancer.
25821000 2015 Risk-reducing mastectomy for BRCA gene mutation carriers.
25816289 2015 Worse breast cancer prognosis of BRCA1/BRCA2 mutation carriers: what's the evidence? A systematic review with meta-analysis.
25808098 2015 Bilateral risk-reduction mastectomy in BRCA1 and BRCA2 mutation carriers: a meta-analysis.
25803638 2015 ?-HPV 5 and 8 E6 disrupt homology dependent double strand break repair by attenuating BRCA1 and BRCA2 expression and foci formation.
25792249 2015 Fertility treatments and invasive epithelial ovarian cancer risk in Jewish Israeli BRCA1 or BRCA2 mutation carriers.
25788227 2015 Cancer risks in Jewish male BRCA1 and BRCA2 mutation carriers.
25777348 2015 BRCA1 and BRCA2 mutations in ethnic Lebanese Arab women with high hereditary risk breast cancer.
25756400 2015 Endometrial cancers in mutation carriers from hereditary breast ovarian cancer syndrome kindreds: report from the Creighton University Hereditary Cancer Registry with review of the implications.
25749384 2015 Fibrillin-1, induced by Aurora-A but inhibited by BRCA2, promotes ovarian cancer metastasis.
25743105 2015 Whole exome sequencing reveals recurrent mutations in BRCA2 and FAT genes in acinar cell carcinomas of the pancreas.
25736863 2015 Phenotypic analysis of familial breast cancer: comparison of BRCAx tumors with BRCA1-, BRCA2-carriers and non-familial breast cancer.
25736055 2015 BRCA/Fanconi anemia pathway implicates chemoresistance to gemcitabine in biliary tract cancer.
25735359 2015 BRCA1 and BRCA2 common mutations in iranian breast cancer patients: a meta analysis.
25734415 2015 Lipid and Metabolite Deregulation in the Breast Tissue of Women Carrying BRCA1 and BRCA2 Genetic Mutations.
25682074 2015 Prevalence of BRCA1 and BRCA2 germline mutations in patients with triple-negative breast cancer.
25675043 2015 Feelings of Women With Strong Family Histories Who Subsequent to Their Breast Cancer Diagnosis Tested BRCA Positive.
25659033 2015 FANCD2, FANCJ and BRCA2 cooperate to promote replication fork recovery independently of the Fanconi Anemia core complex.
25639900 2015 Exceptions to the rule: case studies in the prediction of pathogenicity for genetic variants in hereditary cancer genes.
25613119 2015 Breast Cancer Risk Associated with Estrogen Exposure and Truncating Mutation Location in BRCA1/2 Carriers.
25586199 2015 Two novel frameshift mutations in BRCA2 gene detected by next generation sequencing in a survey of Spanish patients of breast cancer.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
25581732 2015 Evidence for a dualistic model of high-grade serous carcinoma: BRCA mutation status, histology, and tubal intraepithelial carcinoma.
25537514 2015 The BRCA1/2-directed miRNA signature predicts a good prognosis in ovarian cancer patients with wild-type BRCA1/2.
25526195 2014 Germline mutations of DICER1 in Chinese women with BRCA1/BRCA2-negative familial breast cancer.
25522926 2015 Tumor-associated inflammation as a potential prognostic tool in BRCA1/2-associated breast cancer.
25503500 2015 Challenges in managing genetic cancer risk: a long-term qualitative study of unaffected women carrying BRCA1/BRCA2 mutations.
25486196 2014 A cancer-associated mutation inactivates a region of the high-mobility group protein HMG20b essential for cytokinesis.
25476495 2015 Incidence of BRCA1 and BRCA2 non-founder mutations in patients of Ashkenazi Jewish ancestry.
25454609 2015 Effect of BRCA Mutations on Metastatic Relapse and Cause-specific Survival After Radical Treatment for Localised Prostate Cancer.
25445393 2015 BRCA mutations cause reduction in miR-200c expression in triple negative breast cancer.
25437005 2014 A genomic instability score in discriminating nonequivalent outcomes of BRCA1/2 mutations and in predicting outcomes of ovarian cancer treated with platinum-based chemotherapy.
25428789 2015 Inherited predisposition to breast cancer among African American women.
25418591 2014 Screening for common mutations in BRCA1 and BRCA2 genes: interest in genetic testing of Tunisian families with breast and/or ovarian cancer.
25398451 2015 Germline mutation in BRCA1 or BRCA2 and ten-year survival for women diagnosed with epithelial ovarian cancer.
25395318 2014 Novel and recurrent BRCA2 mutations in Italian breast/ovarian cancer families widen the ovarian cancer cluster region boundaries to exons 13 and 14.
25382762 2015 Functional classification of BRCA2 DNA variants by splicing assays in a large minigene with 9 exons.
25380576 2015 BRCA1 alterations are associated with endometriosis, but BRCA2 alterations show no detectable endometriosis risk: a study in Indian population.
25356972 2015 BRCA1, BRCA2, PALB2, and CDKN2A mutations in familial pancreatic cancer: a PACGENE study.
25348552 2014 Association of BRCA2 N372H polymorphism with cancer susceptibility: a comprehensive review and meta-analysis.
25348513 2015 Effects of BRCA1- and BRCA2-related mutations on ovarian and breast cancer survival: a meta-analysis.
25342642 2014 Limited family structure and triple-negative breast cancer (TNBC) subtype as predictors of BRCA mutations in a genetic counseling cohort of early-onset sporadic breast cancers.
25311111 2014 Use of risk-reducing surgeries in a prospective cohort of 1,499 BRCA1 and BRCA2 mutation carriers.
25282148 2014 Structure and mechanism of action of the BRCA2 breast cancer tumor suppressor.
25267367 2015 Neurofibromatosis with male breast cancer--risk factor or co-incidence? Report of two rare cases.
25257187 2014 Salivary gland cancer in BRCA-positive families: a retrospective review.
25251729 2015 Impact of a paternal origin of germline BRCA1/2 mutations on the age at breast and ovarian cancer diagnosis in a Southern Swedish cohort.
25243787 2015 Genetic variants in fanconi anemia pathway genes BRCA2 and FANCA predict melanoma survival.
25218637 2014 RASSF1A-LATS1 signalling stabilizes replication forks by restricting CDK2-mediated phosphorylation of BRCA2.
25195694 2015 BRCA1 and BRCA2 mutations and the risk for colorectal cancer.
25176351 2014 A multi-institutional study of the prevalence of BRCA1 and BRCA2 large genomic rearrangements in familial breast cancer patients.
25154786 2015 Identification of a breast cancer family double heterozygote for RAD51C and BRCA2 gene mutations.
25154392 2015 Patient-derived xenografts reveal that intraductal carcinoma of the prostate is a prominent pathology in BRCA2 mutation carriers with prostate cancer and correlates with poor prognosis.
25136623 2014 BRCA-associated ovarian cancer: from molecular genetics to risk management.
25112434 2015 Prostate cancer in a man with a BRCA2 mutation and a personal history of bilateral breast cancer.
25111659 2014 Subgroups of familial and aggressive prostate cancer with considerable frequencies of BRCA2 mutations.
25101567 2014 The impact of a BRCA2 mutation on mortality from screen-detected prostate cancer.
25099575 2014 Breast-cancer risk in families with mutations in PALB2.
25085752 2014 Development and validation of a new algorithm for the reclassification of genetic variants identified in the BRCA1 and BRCA2 genes.
25082516 2014 Mammography screening and the risk of breast cancer in BRCA1 and BRCA2 mutation carriers: a prospective study.
25070656 2014 From the set-up of a screening program of breast cancer patients to the identification of the first BRCA mutation in the DR Congo.
25066507 2014 Comprehensive BRCA1 and BRCA2 mutational profile in Lithuania.
25053764 2014 Long-term prospective clinical follow-up after BRCA1/2 presymptomatic testing: BRCA2 risks higher than in adjusted retrospective studies.
25047474 2014 Implementing a screening tool for identifying patients at risk for hereditary breast and ovarian cancer: a statewide initiative.
25047471 2014 Comparison of nodal metastasis between BRCA mutation carriers and non-BRCA mutation carriers with breast cancer.
25043256 2014 Up-regulation of the interferon-related genes in BRCA2 knockout epithelial cells.
25036526 2014 Absence of BRCA/FMR1 correlations in women with ovarian cancers.
25011685 2014 Rapid evolution of BRCA1 and BRCA2 in humans and other primates.
24996439 2015 The Fanconi anemia/BRCA pathway is involved in DNA interstrand cross-link repair of adriamycin-resistant leukemia cells.
24951607 2014 Breast cancer, BRCA mutations, and attitudes regarding pregnancy and preimplantation genetic diagnosis.
24947112 2015 Improved overall survival after contralateral risk-reducing mastectomy in BRCA1/2 mutation carriers with a history of unilateral breast cancer: a prospective analysis.
24938600 2014 Association of BRCA2 variants with cardiovascular disease in Saudi Arabia.
24902638 2014 Silencing of BRCA2 decreases anoikis and its heterologous expression sensitizes yeast cells to acetic acid-induced programmed cell death.
24896180 2014 BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
24894343 2014 A multi-institutional study on the association between BRCA1/BRCA2 mutational status and triple-negative breast cancer in familial breast cancer patients.
24890143 2014 BRCA2 promoter polymorphism is associated with breast cancer prognosis in Chinese women.
24884828 2014 BRCA1/2 germline mutations and their clinical importance in Turkish breast cancer patients.
24880342 2014 Rare variants of large effect in BRCA2 and CHEK2 affect risk of lung cancer.
24853100 2014 Genetic anticipation of familial breast cancer with or without BRCA mutation in the Korean population.
24835992 2014 BRCA2 coordinates the activities of cell-cycle kinases to promote genome stability.
24814045 2015 BRCA2 gene: a candidate for clinical testing in familial colorectal cancer type X.
24775809 2014 The negative interplay between Aurora A/B and BRCA1/2 controls cancer cell growth and tumorigenesis via distinct regulation of cell cycle progression, cytokinesis, and tetraploidy.
24771600 2015 A MDP model for breast and ovarian cancer intervention strategies for BRCA1/2 mutation carriers.
24728577 2014 Clinical and molecular characterization of the BRCA2 p.Asn3124Ile variant reveals substantial evidence for pathogenic significance.
24728189 2014 The contribution of deleterious germline mutations in BRCA1, BRCA2 and the mismatch repair genes to ovarian cancer in the population.
24700448 2014 Validation of the Manchester scoring system for predicting BRCA1/2 mutations in 9,390 families suspected of having hereditary breast and ovarian cancer.
24698998 2014 DNA glycosylases involved in base excision repair may be associated with cancer risk in BRCA1 and BRCA2 mutation carriers.
24686251 2014 Large genomic rearrangements of BRCA1 and BRCA2 among patients referred for genetic analysis in Galicia (NW Spain): delimitation and mechanism of three novel BRCA1 rearrangements.
24675954 2014 Cancer suppression by the chromosome custodians, BRCA1 and BRCA2.
24672057 2014 Nedd8-activating enzyme inhibitor MLN4924 provides synergy with mitomycin C through interactions with ATR, BRCA1/BRCA2, and chromatin dynamics pathways.
24627042 2014 The BRCA2 gene is a potential molecular target during 5-fluorouracil therapy in human oral cancer cells.
24607278 2014 Pathogenicity evaluation of BRCA1 and BRCA2 unclassified variants identified in Portuguese breast/ovarian cancer families.
24598993 2014 Tumour suppressor mechanisms in the control of chromosome stability: insights from BRCA2.
24577588 2014 Invasion patterns of metastatic high-grade serous carcinoma of ovary or fallopian tube associated with BRCA deficiency.
24567435 2014 Impact of oophorectomy on cancer incidence and mortality in women with a BRCA1 or BRCA2 mutation.
24566764 2014 Large genomic rearrangement of BRCA1 and BRCA2 genes in familial breast cancer patients in Korea.
24529552 2014 BRCA1/2 mutation carriers are potentially at higher cardiovascular risk.
24519767 2014 Contralateral mastectomy and survival after breast cancer in carriers of BRCA1 and BRCA2 mutations: retrospective analysis.
24518526 2013 BRCA mutations in prostate cancer patients.
24489791 2014 Multifactorial likelihood assessment of BRCA1 and BRCA2 missense variants confirms that BRCA1:c.122A>G(p.His41Arg) is a pathogenic mutation.
24489760 2014 Telomere length shows no association with BRCA1 and BRCA2 mutation status.
24485656 2014 Breast cancer proteins PALB2 and BRCA2 stimulate polymerase ? in recombination-associated DNA synthesis at blocked replication forks.
24479546 2014 RNA profiling reveals familial aggregation of molecular subtypes in non-BRCA1/2 breast cancer families.
24477976 2014 Long-term prognosis of early-onset breast cancer in a population-based cohort with a known BRCA1/2 mutation status.
24473064 2014 PCAT-1, a long noncoding RNA, regulates BRCA2 and controls homologous recombination in cancer.
24472143 2014 Surgically treated ovarian endometriosis association with BRCA1 and BRCA2 mutations.
24448978 2014 Should BRCA2 mutation carriers avoid neoadjuvant chemotherapy?
24442642 2014 Circulating estrogens and estrogens within the breast among postmenopausal BRCA1/2 mutation carriers.
24395671 2014 A novel splice site mutation in the noncoding region of BRCA2: implications for Fanconi anemia and familial breast cancer diagnostics.
24384087 2014 Centrosomal BRCA2 is a target protein of membrane type-1 matrix metalloproteinase (MT1-MMP).
24378620 2014 BRCA mutation carriers do not have compromised ovarian reserve.
24372583 2015 Mutation spectrum and prevalence of BRCA1 and BRCA2 genes in patients with familial and early-onset breast/ovarian cancer from Tunisia.
24348212 2013 BRCA2: one small step for DNA repair, one giant protein purified.
24337145 2014 Mutational analysis of the BRCA2 gene in breast carcinoma patients of Kashmiri descent.
24312913 2013 A comprehensive focus on global spectrum of BRCA1 and BRCA2 mutations in breast cancer.
24306927 2014 Etiology of familial breast cancer with undetected BRCA1 and BRCA2 mutations: clinical implications.
24302565 2015 Consequences of germline variation disrupting the constitutional translational initiation codon start sites of MLH1 and BRCA2: Use of potential alternative start sites and implications for predicting variant pathogenicity.
24301060 2014 Development of primary early-onset colorectal cancers due to biallelic mutations of the FANCD1/BRCA2 gene.
24292448 2014 Incidence of colorectal cancer in BRCA1 and BRCA2 mutation carriers: results from a follow-up study.
24289560 2013 Lack of association of BRCA1 and BRCA2 variants with breast cancer in an ethnic population of Saudi Arabia, an emerging high-risk area.
24289229 2013 Breast cancers with high DSS1 expression that potentially maintains BRCA2 stability have poor prognosis in the relapse-free survival.
24285858 2014 Breast and ovarian cancer risks in a large series of clinically ascertained families with a high proportion of BRCA1 and BRCA2 Dutch founder mutations.
24285840 2013 Increased rate of phenocopies in all age groups in BRCA1/BRCA2 mutation kindred, but increased prospective breast cancer risk is confined to BRCA2 mutation carriers.
24285729 2014 Compensatory functions and interdependency of the DNA-binding domain of BRCA2 with the BRCA1-PALB2-BRCA2 complex.
24281364 2014 BRCA1/2 mutations and FMR1 alleles are randomly distributed: a case control study.
24268522 2014 Chromosome instability and carcinogenesis: insights from murine models of human pancreatic cancer associated with BRCA2 inactivation.
24265793 2013 Tumor mutation burden forecasts outcome in ovarian cancer with BRCA1 or BRCA2 mutations.
24259538 2014 Fanconi anaemia, BRCA2 mutations and childhood cancer: a developmental perspective from clinical and epidemiological observations with implications for genetic counselling.
24244370 2013 An integrated inspection of the somatic mutations in a lung squamous cell carcinoma using next-generation sequencing.