Property Summary

NCBI Gene PubMed Count 37
PubMed Score 16.48
PubTator Score 39.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 1.6e-06
osteosarcoma -2.240 6.2e-09
medulloblastoma, large-cell -1.100 2.8e-03
lung cancer 1.400 1.1e-02
group 3 medulloblastoma 1.100 3.4e-02
Pick disease 1.200 8.3e-05
ovarian cancer -1.400 2.6e-06

Protein-protein Interaction (3)

Gene RIF (26)

PMID Text
25820252 Together the results indicate for the first time that BRAP2 may play an important NRNI role in germ cells of the testis, with an additional, scaffold/structural role in mature spermatozoa.
24454952 BRAP gene may confer vulnerability for schizophrenia in Han Chinese population.
23707952 ectopic expression of BRAP2 inhibits nuclear localization of HMG20A and NuMA1, and prevents nuclear envelope accumulation of SYNE2.
23554956 Brap2 regulates temporal control of NF-kappaB localization mediated by inflammatory response.
23526420 BAP1 expression closely correlates with age, clinical stage, pathologic differentiation and histological type in colorectal cancer (CRC). BAP1 may serve as a novel prognostic biomarker for CRC.
23356535 The BRAP polymorphism may not play an important role in ischemic stroke in the Taiwanese population.
23105109 The dominant effect of prolonged USP15 depletion upon signal amplitude is due to a decrease in CRAF levels while allowing for the possibility that USP15 may also function to dampen MAPK signaling through direct stabilization of BRAP.
22965072 genetic association studies in population of Chinese Han young adults in Beijing: Data suggest that 2 SNPs in BRAP (rs11066001; rs3782886) are associated with decreased risk of metabolic syndrome in this population.
22122968 ANRIL on 9p21 and BRAP were both associated with ankle brachial index in a Taiwanese population.
22085839 BRAP gene is associated with the extent of coronary atherosclerosis and has a synergistic effect with diabetes on the occurrence of significant CAD in the Chinese population
22078348 Several BRCA1 mutations were observed in Pakistani breast cancer patients with moderate family history.
22022282 our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains.
21857995 Data show that BRAP locates in the membrane and cytoplasm, suggesting that this protein is a cytoplasm protein, which promotes cell cycle and wound repair of HBECs.
21670849 Data show that BRAP conferred a risk for carotid plaque and intima-medial thickness.
21301165 Polymorphism of 270 A > G in BRAP is Associated with Lower Ankle-Brachial Index and peripheral artery disease.
20040518 All results are consistent with BRAP2 being a novel, phosphorylation-regulated negative regulator of nuclear import, with potential as an antiviral agent.
19713974 Data indicate that one SNP in BRAP showed(rs11066001) a significant association in allele frequency distribution with CAD in both the Japanese and Korean populations.
19198608 SNPs in BRAP associated with risk of myocardial infarction in Asian populations.BRAP knockdown in cultured coronary endothelial cells suppressed activation of NF-kappaB.
19198608 Observational study of gene-disease association. (HuGE Navigator)
19152073 The authors found that Brap2, which has intrinsic RING domain dependent E3 ligase activity, facilitates HsCdc14A Lys-63 linked ubiquitin modification, indicating that Brap2 may be the ubiquitin E3 Ligase of HsCdc14A.
19009954 Carriers of mutations in the genes BRCA1/2 may present a specific high risk group for PABC especially at younger ages.
18577512 p21 Ras/Imp regulate cytokine production and migration in CD4 T cells [Imp]
18380995 The most current evidence suggests that it may be more beneficial in those with BRCA mutations because tumors associated with these mutations are likely to be estrogen-receptor positive.
18332145 the capacity of IMP to inhibit signal propagation through Raf to MEK is a consequence of disrupting KSR1 homooligomerization and B-Raf/c-Raf hetero-oligomerization
15340083 Monocytic differentiation of the promyelomonocytic cell lines U937 and HL60 is associated with the upregulation of Brap2 expression concomitantly with the upregulation and cytoplasmic relocalization of p21.
14724641 modulates sensitivity of the MAP kinase cascade to stimulus-dependent activation by limiting functional assembly of the core enzymatic components through the inactivation of KSR

AA Sequence

MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMT      1 - 70
DVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHG     71 - 140
IMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRA    141 - 210
QADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILT    211 - 280
TLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFE    281 - 350
ETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR    351 - 420
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEE    421 - 490
QEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEG    491 - 560
QINIAMASASSPASSGGSGKLPSRKGRSKRGK                                          561 - 592
//

Text Mined References (46)

PMID Year Title
25820252 2015 Interactome of the negative regulator of nuclear import BRCA1-binding protein 2.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24454952 2014 A two-stage association study suggests BRAP as a susceptibility gene for schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23707952 2013 The BRCA1-binding protein BRAP2 can act as a cytoplasmic retention factor for nuclear and nuclear envelope-localizing testicular proteins.
23554956 2013 Brap2 regulates temporal control of NF-?B localization mediated by inflammatory response.
23526420 2013 Prognostic significance of BRCA1-associated protein 1 in colorectal cancer.
23356535 2013 Lack of association between a functional variant of the BRCA-1 related associated protein (BRAP) gene and ischemic stroke.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105109 2012 Direct and indirect control of mitogen-activated protein kinase pathway-associated components, BRAP/IMP E3 ubiquitin ligase and CRAF/RAF1 kinase, by the deubiquitylating enzyme USP15.
22965072 2013 The single nucleotide polymorphisms in BRAP decrease the risk of metabolic syndrome in a Chinese young adult population.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22122968 2012 Additive effect of ANRIL and BRAP polymorphisms on ankle-brachial index in a Taiwanese population.
22085839 2011 Synergistic effect between BRAP polymorphism and diabetes on the extent of coronary atherosclerosis in the Chinese population.
22078348 2011 BRCA1 status in Pakistani breast cancer patients with moderate family history.
22022282 2011 A phenomics-based strategy identifies loci on APOC1, BRAP, and PLCG1 associated with metabolic syndrome phenotype domains.
21857995 2011 Cloning of a novel protein interacting with BRS-3 and its effects in wound repair of bronchial epithelial cells.
21670849 BRAP Activates Inflammatory Cascades and Increases the Risk for Carotid Atherosclerosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21372407 2011 Confirmation of ALDH2 as a Major locus of drinking behavior and of its variants regulating multiple metabolic phenotypes in a Japanese population.
21301165 2011 Polymorphism of 270 A > G in BRAP is Associated with Lower Ankle-Brachial Index in a Taiwanese Population.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20040518 2010 The BRCA-1 binding protein BRAP2 is a novel, negative regulator of nuclear import of viral proteins, dependent on phosphorylation flanking the nuclear localization signal.
19713974 2009 Validation of eight genetic risk factors in East Asian populations replicated the association of BRAP with coronary artery disease.
19698717 2009 Functional variants in ADH1B and ALDH2 coupled with alcohol and smoking synergistically enhance esophageal cancer risk.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19198608 2009 SNPs in BRAP associated with risk of myocardial infarction in Asian populations.
19152073 2009 Brap2 facilitates HsCdc14A Lys-63 linked ubiquitin modification.
19009954 2008 Pregnancy-associated breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18577512 2008 p21 Ras/impedes mitogenic signal propagation regulates cytokine production and migration in CD4 T cells.
18380995 2008 55-year-old woman with menopausal symptoms and a family history of breast cancer.
18332145 2008 IMP modulates KSR1-dependent multivalent complex formation to specify ERK1/2 pathway activation and response thresholds.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340083 2004 Brap2 functions as a cytoplasmic retention protein for p21 during monocyte differentiation.
14724641 2004 Ras regulates assembly of mitogenic signalling complexes through the effector protein IMP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10777491 2000 Nuclear transport of human DDB protein induced by ultraviolet light.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9497340 1998 Identification of a novel cytoplasmic protein that specifically binds to nuclear localization signal motifs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.