Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.55
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Spermatogenic Failure, Nonobstructive, Y-Linked 13 0.0 0.0
Disease Target Count
Azoospermia 106
Disease Target Count P-value
psoriasis 6514 2.6e-03
Disease Target Count Z-score Confidence
Gonadoblastoma 30 3.718 1.9

Gene RIF (5)

AA Sequence

MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLT      1 - 70
YYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK                                       71 - 106
//

Text Mined References (11)

PMID Year Title