Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.13
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (1)

AA Sequence

MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT      1 - 70
IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA     71 - 140
YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM    141 - 210
NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN    211 - 280
SAGVLATLRNYDYYASRVPESIKNALVP                                              281 - 308
//

Text Mined References (14)

PMID Year Title