Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.23
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 5.2e-06
psoriasis 6694 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Aseptic Meningitis 6 3.364 1.7

Gene RIF (3)

AA Sequence

MLRILCLALCSLLTGTRADPGALLRLGMDIMNQVQSAMDESHILEKMAAEAGKKQPGMKPIKGITNLKVK      1 - 70
DVQLPVITLNFVPGVGIFQCVSTGMTVTGKSFMGGNMEIIVALNITATNRLLRDEETGLPVFKSEGCEVI     71 - 140
LVNVKTNLPSNMLPKMVNKFLDSTLHKVLPGLMCPAIDAVLVYVNRKWTNLSDPMPVGQMGTVKYVLMSA    141 - 210
PATTASYIQLDFSPVVQQQKGKTIKLADAGEALTFPEGYAKGSSQLLLPATFLSAELALLQKSFHVNIQD    211 - 280
TMIGELPPQTTKTLARFIPEVAVAYPKSKPLTTQIKIKKPPKVTMKTGKSLLHLHSTLEMFAARWRSKAP    281 - 350
MSLFLLEVHFNLKVQYSVHENQLQMATSLDRLLSLSRKSSSIGNFNERELTGFITSYLEEAYIPVVNDVL    351 - 420
QVGLPLPDFLAMNYNLAELDIVENALMLDLKLG                                         421 - 453
//

Text Mined References (10)

PMID Year Title