Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.23
PubTator Score 1.03

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 5.2e-06
psoriasis 6685 1.3e-03
Disease Target Count Z-score Confidence
Aseptic Meningitis 6 3.34 1.7

Gene RIF (2)

20237496 Observational study of gene-disease association. (HuGE Navigator)
12185532 BPIL3 maps to Chromosome 20q11; thus, these novel genes form a cluster with BPI and two other members of the LT/LBP gene family on the long arm of human Chr 20. AA sequence is reported.

AA Sequence

QVGLPLPDFLAMNYNLAELDIVENALMLDLKLG                                         421 - 453

Text Mined References (10)

PMID Year Title
26962226 2016 BPIFB6 Regulates Secretory Pathway Trafficking and Enterovirus Replication.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
21076407 2010 A de novo paradigm for mental retardation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185532 2002 Three new human members of the lipid transfer/lipopolysaccharide binding protein family (LT/LBP).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.