Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.41
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 7.6e-05
chronic rhinosinusitis 512 2.2e-02
Disease Target Count Z-score Confidence
Hepatitis E 11 3.162 1.6
Common cold 63 3.028 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.096 7.6e-05
chronic rhinosinusitis 2.092 2.2e-02

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
12185532 BPIL1 maps to Chromosome 20q11; thus, these novel genes form a cluster with BPI and two other members of the LT/LBP gene family on the long arm of human Chr 20. AA sequence is reported.

AA Sequence

MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIR      1 - 70
ILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLF     71 - 140
SGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSV    141 - 210
PTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLD    211 - 280
ITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNS    281 - 350
AFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNA    351 - 420
LLAMGIALPGVVNLHYVAPEIFVYEGYVVISSGLFYQS                                    421 - 458
//

Text Mined References (18)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12837268 2003 Expansion of the BPI family by duplication on human chromosome 20: characterization of the RY gene cluster in 20q11.21 encoding olfactory transporters/antimicrobial-like peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185532 2002 Three new human members of the lipid transfer/lipopolysaccharide binding protein family (LT/LBP).
11971875 2002 PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11018263 2000 Characterisation of the human plunc gene, a gene product with an upper airways and nasopharyngeal restricted expression pattern.