Property Summary

NCBI Gene PubMed Count 68
PubMed Score 158.57
PubTator Score 122.42

Knowledge Summary

Patent

No data available

Gene RIF (54)

PMID Text
26658012 These studies identify the role of SPLUNC1 in sinonasal innate immunity and the pathogenesis of CRS. Defective expression of SPLUNC1 in CRSwNP patients may lead to insufficient maintenance of the epithelial barrier function
26559477 PLUNC is a protein of the tear film and suggest that it plays a role in fluid balance and surface tension regulation at the ocular surface.
26090599 High serum SPLUNC1 levels are associated with Pleural Effusion from Lung Cancer Compared to Tuberculosis.
25891128 SPLUNC1 can weaken the inflammatory response induced by EBV infection in NPC cells through the regulation of the TLR9/NF-kappaB signaling pathway and control of the tumor inflammatory microenvironment
25600649 LUNX silencing disrupted primary tumor growth, local invasion, and metastatic colonization
25574903 The G allele of rs1078761 may be detrimental to lung function in cystic fibrosis owing to decreased levels of BPIFA1 and BPIFB1.
25425729 pleural fluid LUNX mRNA provided a valuable adjunct in distinguishing malignant pleural effusion caused by lung cancer from benign pleural effusion
25223608 discoveries provide insight into the specific determinants governing the interaction between SPLUNC1 and lipids and also shed light on novel functions that SPLUNC1 and other PLUNC family members perform in host defense
25161098 12 retinoid X receptors heterodimer binding sites exist in the SPLUNC1 promoter region, which is up-regulated by all-trans-retinoic acid. SPLUNC1 plays a role in ATRA-induced growth inhibition and differentiation in nasopharyngeal carcinoma cells.
25136695 The observations suggest that, in response to agents or chemical factors, nasal mucosal epithelium will react and produce PLUNC proteins
24512783 The correlation between SPLUNC1 levels and Vol2(increase) in non-smokers may indicate involvement of SPLUNC1in the regulation of the normal function of the nasal mucosa.
24342548 SPLUNC1 is differentially modulated in eosinophilic and noneosinophilic chronic rhinosinusitis with nasal polyps.
24269518 Our results indicate that BPIFA1 is a novel target for autoantibodies in cystic fibrosis.
24124190 the epithelial sodium channel inhibitory domain of SPLUNC1 may be cleaved away from the main molecule by neutrophil elastase
24043776 Short palate lung and nasal epithelial clone 1, the most abundant gene in airway epithelia, is the extracellular pH-sensitive factor that inhibits ENaC in normal but not cystic fibrosis airways.
23810363 High LUNX mRNA expression correlated with lung cancer stage and distant metastases.
23759037 The changes in Lunx mRNA levels after chemotherapy can predict the prognosis of patients with MPEs caused by pulmonary carcinoma.
23741370 SPLUNC1 degradation by neutrophil elastase may increase airway susceptibility to bacterial infections.
23721177 Data indicate that SPLUNC1 is an important component of mucosal innate immune defense against pulmonary inhaled particles.
23644997 In patients with chronic rhinosinusitis with nasal polyps, decreased PLUNC expression is associated with multibacterial colonization, specifically those mediated by Staphyloccocus aureus and Pseudomonas aeruginosa.
23499554 SPLUNC1 is a crucial component of mucosal innate immune defense against pulmonary infection.
23472073 SPLUNC1 regulates NPC cell proliferation, differentiation and apoptosis through miR-141, which in turn regulates PTEN and p27 expression, and is negatively regulated by LMP1
23371910 Sinusitis with positive P. aeruginosa bacterial culture is associated with decreased SPLUNC1 sinus mucosa expression. Repeated sinus surgeries are more frequently needed for these patients.
23132494 P. aeruginosa treated with recombinant human SPLUNC1 protein showed decreased growth in vitro.
22676062 Reduced expression of antimicrobial PLUNC proteins in nasal polyp tissues of patients with chronic rhinosinusitis
22213098 genetic polymorphisms of SPLUNC1 protein confer risk of nasopharyngeal carcinoma in a Malaysian Chinese population
21805676 RSV-positive boys had significantly less 25 kDa SPLUNC1 than RSV-negative boys while there were no significant differences among girls
21787346 BPIFA1 protein displays bacteriocidal activity against Gram-negative bacteria.
21787339 PLUNC is a multifunctional protein, which plays a novel role in airway defences at the air/liquid interface
21632717 PLUNC transgene is associated with enhanced bacterial killing and decreased inflammation after exposure with a major human airway pathogen, the Gram-negative bacterium Pseudomonas aeruginosa, both in vitro and in vivo.
21200090 The LUNX mRNA expression in the lymph nodes was closely related to the pathological type, cancer cell differentiation and clinical stage of non-small cell lung cancer.
20949060 data have provided the first in vivo evidence that cSPLUNC1 functions to maintain homeostasis of the upper airway and, thereby, is critical for protection of the middle ear
20855242 LUNX gene sequences from +3770 to +3959 bp and +14553 to +14652 bp possess the capacity to enhance gene transcription.
20519934 SPLUNC1 potently reduced surface levels of the epithelial sodium channel (ENaC)in bronchial epithelial cells and Xenopus laevis oocytes.
20161732 Data suggest that the PLUNC protein contributes to the surfactant properties of airway secretions, and that this activity may interfere with biofilm formation by an airway pathogen.
19650845 Observational study of gene-disease association. (HuGE Navigator)
19541605 SPLUNC1 is secreted onto mucosal surfaces as a soluble volume sensor whose concentration and dilution can regulate ENaC activity and mucosal volumes, including that of airway surface liquid.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19119597 Expression of Cu/ZnSOD and PLUNC in in chronic sinusitis was higher than in normal tissue, and expression in nasal polyp tissue was lower than in normal tissue.
18646695 mRNA expression of LUNX, CK19 and CEA genes in the regional lymph nodes of NSCLC was significantly higher than that in those of benign lung diseases.
18513434 LunX mRNA is the most specific gene marker for lung cancer and has potential diagnostic utility when measured in the peripheral blood and pleural fluid.
18245229 Immunoblots performed on polymorphonuclear cell lysates and subcellular fractions indicate that PLUNC is present in the specific granules of the neutrophil.
18204429 PLUNC is a novel marker that distinguishes gastric hepatoid adenocarcinoma from primary hepatocellular carcinoma
18049866 This study shows that SPLUNC1 not only has the role of antibacteria and antivirus, but also inhibits the potential oncogenicity of epstein barr virus in respiratory epithelium.
17988392 SPLUNC1 is specifically and significantly increased in the epithelial cells of small airways of lungs from patients with cystic fibrosis.
17785110 Observational study of gene-disease association. (HuGE Navigator)
16364440 This research sheds new light on the mechanism of SPLUNC1 involvement in the host upper respiratory tract defense system.
16195890 SPLUNC1 protein is expressed at not only the serous glands and epithelium of the upper respiratory tract and digestive tract, but also in the oculi of embryos.
15313462 PLUNC proteins mediate host defense functions in the oral, nasal and respiratory epithelia [review].
12920053 This study showed that plunc gene product is expressed both in vivo and in vitro, detailed a method for its purification and provided basic information on its biochemical properties in secretions.
12874788 SPLUNC1 is found to be down-expressed in 34 of 48 nasopharyngeal carcinoma biopsies.
12753706 There were three splicing variants in NASG 3'UTR. Its abnormal expression may be an important molecular event in NPC and lung cancer.
12409287 results provide the cloning and characterization of a tissue-specific novel gene and its possible relationship with airway diseases
11971875 members of the PLUNC family may function in the innate immune response in regions of the mouth, nose and lungs, which are sites of significant bacterial exposure

AA Sequence

MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN      1 - 70
LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ     71 - 140
VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI    141 - 210
LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV                            211 - 256
//

Text Mined References (69)

PMID Year Title
26658012 2016 Differential short palate, lung, and nasal epithelial clone 1 suppression in eosinophilic and noneosinophilic chronic rhinosinusitis with nasal polyps: implications for pathogenesis and treatment.
26559477 2015 Palate Lung Nasal Clone (PLUNC), a Novel Protein of the Tear Film: Three-Dimensional Structure, Immune Activation, and Involvement in Dry Eye Disease (DED).
26090599 2015 SPLUNC1 Is a Significant Marker in Pleural Effusion from Lung Cancer Compared to Tuberculosis.
25891128 2015 SPLUNC1 reduces the inflammatory response of nasopharyngeal carcinoma cells infected with the EB virus by inhibiting the TLR9/NF-?B pathway.
25600649 2015 Targeting LUNX inhibits non-small cell lung cancer growth and metastasis.
25574903 2015 Polymorphisms associated with expression of BPIFA1/BPIFB1 and lung disease severity in cystic fibrosis.
25425729 2014 Diagnostic utility of LUNX mRNA and VEGF mRNA in pleural fluid for differentiating benign from malignant origin.
25416956 2014 A proteome-scale map of the human interactome network.
25223608 2014 Structural characterization of the pulmonary innate immune protein SPLUNC1 and identification of lipid ligands.
25161098 2014 SPLUNC1 is associated with nasopharyngeal carcinoma prognosis and plays an important role in all-trans-retinoic acid-induced growth inhibition and differentiation in nasopharyngeal cancer cells.
25136695 2014 PLUNC proteins positivity in patients with chronic rhinosinusitis: a case-control study.
24512783 2014 The effects of physical exercise and smoking habits on the expression of SPLUNC1 in nasal lavage fluids from allergic rhinitis subjects.
24342548 2014 The antimicrobial protein short palate, lung, and nasal epithelium clone 1 (SPLUNC1) is differentially modulated in eosinophilic and noneosinophilic chronic rhinosinusitis with nasal polyps.
24269518 2014 Anti-BPIFA1/SPLUNC1: a new autoantibody prevalent in patients with endstage cystic fibrosis.
24124190 2013 Identification of the SPLUNC1 ENaC-inhibitory domain yields novel strategies to treat sodium hyperabsorption in cystic fibrosis airway epithelial cultures.
24043776 2013 Molecular basis for pH-dependent mucosal dehydration in cystic fibrosis airways.
23810363 2013 Multiplex PCR-based detection of circulating tumor cells in lung cancer patients using CK19, PTHrP, and LUNX specific primers.
23759037 2013 Superiority and clinical significance of Lunx mRNA in the diagnosis of malignant pleural effusion caused by pulmonary carcinoma.
23741370 2013 Human neutrophil elastase degrades SPLUNC1 and impairs airway epithelial defense against bacteria.
23721177 2013 Dual acute proinflammatory and antifibrotic pulmonary effects of short palate, lung, and nasal epithelium clone-1 after exposure to carbon nanotubes.
23644997 2014 Decreased PLUNC expression in nasal polyps is associated with multibacterial colonization in chronic rhinosinusitis patients.
23499554 2013 SPLUNC1/BPIFA1 contributes to pulmonary host defense against Klebsiella pneumoniae respiratory infection.
23472073 2013 SPLUNC1 regulates cell progression and apoptosis through the miR-141-PTEN/p27 pathway, but is hindered by LMP1.
23371910 2013 Decreased SPLUNC1 expression is associated with Pseudomonas infection in surgically treated chronic rhinosinusitis patients who may require repeated sinus surgery.
23132494 2013 Multifunctional role of human SPLUNC1 in Pseudomonas aeruginosa infection.
22676062 2012 Reduced expression of antimicrobial PLUNC proteins in nasal polyp tissues of patients with chronic rhinosinusitis.
22213098 2012 Identification of a functional variant in SPLUNC1 associated with nasopharyngeal carcinoma susceptibility among Malaysian Chinese.
21805676 2011 Innate immunity proteins and a new truncated form of SPLUNC1 in nasopharyngeal aspirates from infants with respiratory syncytial virus infection.
21787346 2011 Functional roles of SPLUNC1 in the innate immune response against Gram-negative bacteria.
21787339 2011 PLUNC: a multifunctional surfactant of the airways.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
21632717 2011 Antimicrobial activity of PLUNC protects against Pseudomonas aeruginosa infection.
21200090 2010 [LUNX mRNA in regional lymph nodes of non-small cell lung cancer patients by RT-PCR and its clinical significance].
20949060 2010 The multifunctional host defense peptide SPLUNC1 is critical for homeostasis of the mammalian upper airway.
20855242 2010 [Cloning of human LUNX gene enhancers and analysis of transcriptional regulation].
20519934 SPLUNC1 expression reduces surface levels of the epithelial sodium channel (ENaC) in Xenopus laevis oocytes.
20161732 2010 PLUNC is a novel airway surfactant protein with anti-biofilm activity.
19650845 2010 CLC- a novel susceptibility gene for allergic rhinitis?
19541605 2009 SPLUNC1 regulates airway surface liquid volume by protecting ENaC from proteolytic cleavage.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19119597 2008 [Expression and significance of Cu/ZnSOD and PLUNC protein in chronic sinusitis and nasal polyp tissue].
18646695 2008 [Message RNA expression of LUNX, CK19 and CEA genes in NSCLC with micrometastasis in lymph nodes].
18513434 2008 Diagnostic utility of LunX mRNA in peripheral blood and pleural fluid in patients with primary non-small cell lung cancer.
18245229 2008 PLUNC is a secreted product of neutrophil granules.
18204429 2008 Gene expression profiling with microarray and SAGE identifies PLUNC as a marker for hepatoid adenocarcinoma of the stomach.
18049866 2008 Effect of SPLUNC1 protein on the Pseudomonas aeruginosa and Epstein-Barr virus.
17988392 2007 Differential epithelial expression of the putative innate immune molecule SPLUNC1 in cystic fibrosis.
17785110 2007 [Association of the coding region single nucleotide polymorphisms in PLUNC gene with nasopharyngeal carcinoma].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16364440 2006 Intracellular co-localization of SPLUNC1 protein with nanobacteria in nasopharyngeal carcinoma epithelia HNE1 cells depended on the bactericidal permeability increasing protein domain.
16195890 2006 Tissue distribution of the secretory protein, SPLUNC1, in the human fetus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15313462 2004 Host defense in oral and airway epithelia: chromosome 20 contributes a new protein family.
15158712 2004 PLUNC in human nasal lavage fluid: multiple isoforms that bind to lipopolysaccharide.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12920053 2004 Purification and characterization of PLUNC from human tracheobronchial secretions.
12874788 2003 Identification of tissue-specific genes in nasopharyngeal epithelial tissue and differentially expressed genes in nasopharyngeal carcinoma by suppression subtractive hybridization and cDNA microarray.
12753706 2003 [Analysis of splicing variants in NASG 3'UTR, down-regulated in nasopharyngeal carcinoma, and its expression in multiple cancer tissues].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12409287 2003 Molecular cloning and characterization of spurt, a human novel gene that is retinoic acid-inducible and encodes a secretory protein specific in upper respiratory tracts.
11971875 2002 PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.
11821380 2002 Plunc, a member of the secretory gland protein family, is up-regulated in nasal respiratory epithelium after olfactory bulbectomy.
11788998 2002 Newly identified proteins in human nasal lavage fluid from non-smokers and smokers using two-dimensional gel electrophoresis and peptide mass fingerprinting.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11425234 2001 Identification of a new potential airway irritation marker, palate lung nasal epithelial clone protein, in human nasal lavage fluid with two-dimensional electrophoresis and matrix-assisted laser desorption/ionization-time of flight.
11251963 2001 Isolation of a novel human lung-specific gene, LUNX, a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.
11018263 2000 Characterisation of the human plunc gene, a gene product with an upper airways and nasopharyngeal restricted expression pattern.