Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.39
PubTator Score 18.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 3.7e-06
group 3 medulloblastoma 1.900 2.8e-06
lung cancer 1.400 3.9e-04
diabetes mellitus 1.300 1.8e-03
lung carcinoma 1.100 9.2e-19

Protein-protein Interaction (4)

Gene RIF (5)

PMID Text
25333274 The catalytic efficiency (kcat/Km) of rBPHL for homocysteine thiolactone hydrolysis was 7.7 x 10(4) M(-1)s(-1), orders of magnitude higher than that of PON1 or Blmh, indicating a more significant physiological role for BPHL in detoxifying HCTL
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
15832508 BPHL catalyzes the hydrolytic activation of the antiviral prodrugs valacyclovir and valganciclovir.
12732646 BPHL is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nuceloside analogs such as valacyclovir and valganciclovir.

AA Sequence

MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGML      1 - 70
GSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSD     71 - 140
GGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWV    141 - 210
DGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFAD    211 - 280
EFNKLAEDFLQ                                                               281 - 291
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25333274 2014 Human valacyclovir hydrolase/biphenyl hydrolase-like protein is a highly efficient homocysteine thiolactonase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18256025 2008 Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
18163890 2008 HNF4 alpha orchestrates a set of 14 genes to down-regulate cell proliferation in kidney cells.
16316342 2005 Transcriptional analysis of the molecular basis of human kidney aging using cDNA microarray profiling.
16028355 Structure and specificity of a human valacyclovir activating enzyme: a homology model of BPHL.
15832508 A novel nucleoside prodrug-activating enzyme: substrate specificity of biphenyl hydrolase-like protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12732646 2003 Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9721218 1998 Structural characterization and chromosomal localization of the gene encoding human biphenyl hydrolase-related protein (BPHL).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7759552 1995 Cloning and expression analysis of a novel human serine hydrolase with sequence similarity to prokaryotic enzymes involved in the degradation of aromatic compounds.
2393862 1990 Cloning and sequencing of a complementary DNA encoding a Mr 70,000 human breast epithelial mucin-associated antigen.