Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.61
PubTator Score 1.25

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.096 3.9e-02
Alzheimer's disease -1.100 3.2e-02
diabetes mellitus -1.500 1.8e-03
group 4 medulloblastoma -1.100 6.0e-03
hereditary spastic paraplegia -1.128 1.5e-02
lung adenocarcinoma -1.200 9.8e-17
medulloblastoma, large-cell -1.100 1.2e-03
non-small cell lung cancer -1.158 8.4e-18
ovarian cancer -3.000 7.5e-09
pancreatic ductal adenocarcinoma liver m... -2.959 4.6e-03
Pick disease -1.400 9.6e-06
progressive supranuclear palsy -1.400 5.9e-03


Accession Q96B45 B2R488 B3KUW4 C9K0X3
Symbols C10orf32


  Ortholog (2)

Gene RIF (3)

AA Sequence

KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK                                        71 - 105

Text Mined References (17)

PMID Year Title