Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.61
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
medulloblastoma -1.200 9.4e-04
medulloblastoma, large-cell -1.100 1.2e-03
hereditary spastic paraplegia -1.128 1.5e-02
pancreatic ductal adenocarcinoma liver m... -2.959 4.6e-03
non-small cell lung cancer -1.158 8.4e-18
diabetes mellitus -1.500 1.8e-03
lung adenocarcinoma -1.500 1.5e-12
aldosterone-producing adenoma -1.096 3.9e-02
Alzheimer's disease -1.100 3.2e-02
Pick disease -1.400 9.6e-06
progressive supranuclear palsy -1.400 5.9e-03
ovarian cancer -3.000 7.5e-09

Synonym

Accession Q96B45 B2R488 B3KUW4 C9K0X3
Symbols C10orf32

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MATGTPESQARFGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLR      1 - 70
KMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK                                        71 - 105
//

Text Mined References (14)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22383894 2012 Genome-wide association study identifies chromosome 10q24.32 variants associated with arsenic metabolism and toxicity phenotypes in Bangladesh.
19915575 2009 Genome-wide association study reveals genetic risk underlying Parkinson's disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.