Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.22
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MESSRGRPGPETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVV      1 - 70
HRPEREALENEPGPQGTLSGAGSRRGAPGAEHEPSLSSRHKNPAPPEGKPSSGRDCRRGGPGGGMDVEQQ     71 - 140
EEEDNDEEAAAGSRAGRSFSSRLQDSRSLDGLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRH    141 - 210
GDLTHFVANNLQLKIRLSGAPPPPPSAPARPCPAPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLR    211 - 280
GLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLE    281 - 350
VLEALCK                                                                   351 - 357
//

Text Mined References (13)

PMID Year Title