Property Summary

NCBI Gene PubMed Count 24
PubMed Score 71.92
PubTator Score 69.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (16)

AA Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAG      1 - 70
VSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTY     71 - 140
HNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLY    141 - 210
LQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWS    211 - 280
IHY                                                                       281 - 283
//

Text Mined References (25)

PMID Year Title