Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.70
PubTator Score 4.88

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
ovarian cancer 2.200 3.2e-05
Breast cancer 1.300 6.5e-07


Accession Q53S33 G3XAB0
Symbols MMDS2


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

24334290 Clinical features of BOLA3-associated variant nonketotic hyperglycemia include severe neurodegeneration after a period of normal development.
22562699 BOLA3 plays a crucial role in the biogenesis of iron-sulfur clusters.
21944046 Mutations in iron-sulfur cluster scaffold genes NFU1 and BOLA3 cause a fatal deficiency of multiple respiratory chain and 2-oxoacid dehydrogenase enzymes [case report]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18548201 This study reported that all three human BolA proteins (hBolA1, hBolA2, and hBolA3) are novel non-classical secreted proteins identified with bioinformatics and molecular biology experiments.
14718656 BOLA-like proteins are widely conserved from prokaryotes to eukaryotes and may be involved in cell proliferation or cell-cycle regulation.

AA Sequence

EFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR                                      71 - 107

Text Mined References (12)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
24334290 2014 Variant non ketotic hyperglycinemia is caused by mutations in LIAS, BOLA3 and the novel gene GLRX5.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22562699 2013 Homozygous missense mutation in BOLA3 causes multiple mitochondrial dysfunctions syndrome in two siblings.
21944046 2011 Mutations in iron-sulfur cluster scaffold genes NFU1 and BOLA3 cause a fatal deficiency of multiple respiratory chain and 2-oxoacid dehydrogenase enzymes.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18548201 2008 hBolA, novel non-classical secreted proteins, belonging to different BolA family with functional divergence.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14718656 2004 Solution structure of a BolA-like protein from Mus musculus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.