Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.11
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 1.9e-06
medulloblastoma, large-cell -1.100 2.9e-02
intraductal papillary-mucinous adenoma (... 1.100 2.0e-03

Synonym

Accession Q9Y3E2 B2R7K2 D3DUZ4 Q5QNY0
Symbols CGI-143

Gene

PDB

5LCI  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (4)

PMID Text
22746225 is an aerobic, mitochondrial protein that prevents mitochondrial morphology aberrations induced by GSH depletion and reduces the associated oxidative shift of the mitochondrial thiol redox potential
20877624 Observational study of gene-disease association. (HuGE Navigator)
18548201 This study reported that all three human BolA proteins (hBolA1, hBolA2, and hBolA3) are novel non-classical secreted proteins identified with bioinformatics and molecular biology experiments.
14718656 BOLA-like proteins are widely conserved from prokaryotes to eukaryotes and may be involved in cell proliferation or cell-cycle regulation.

AA Sequence

MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRV      1 - 70
AVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP        71 - 137
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22746225 2013 BOLA1 is an aerobic protein that prevents mitochondrial morphology changes induced by glutathione depletion.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18548201 2008 hBolA, novel non-classical secreted proteins, belonging to different BolA family with functional divergence.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718656 2004 Solution structure of a BolA-like protein from Mus musculus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.