Property Summary

NCBI Gene PubMed Count 24
PubMed Score 37.85
PubTator Score 65.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (11)

PMID Text
24806027 Data suggest that hypoxia-induced expression of BOK in placental cells is regulated via promoter region, hypoxia-response element, and binding of hypoxia-inducible factors (HIF1A, HIF2A/EPAS1, HIF1B/ARNT) but is not affected by its antisense transcript.
24113155 First evidence for a key role of the BOK-MCL1 system in regulating autophagy in the human placenta, whereby an adverse environment as seen in preeclampsia tilts the BOK-MCL1 balance toward the build-up of isoforms that triggers placental autophagy.
23884412 Bok may govern IP3R cleavage and activity during apoptosis.
20673843 The results suggest important roles for Bok and Bcl-X(L) in human ovarian development, follicle maturation and apoptosis.
19942931 Data conclude that Mtd-L functions to regulate trophoblast cell proliferation during early placentation and that the elevated levels of Mtd found in PE may contribute to increased trophoblast proliferation.
19287972 BOKAS is a natural antisense transcript that regulates the pro-apoptotic activity of human Bok
16772296 Bok represents a cell cycle-regulated pro-apoptotic member of the Bcl-2 family
16302269 a link between the apoptotic activity and nuclear localization of a pro-apoptotic Bok
15868100 Studies showed that hBok was distributed in both the cytosol and intracellular membranes of healthy cells.
15775999 A novel Mtd/BOK splice isoform is responsible for trophoblast cell death in pre-eclampsia.
15102863 BOK and NOXA are essential mediators of p53-dependent apoptosis

AA Sequence

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVL      1 - 70
LRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQ     71 - 140
AQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLP    141 - 210
ER                                                                        211 - 212
//

Text Mined References (26)

PMID Year Title
27505430 2016 Bok is a genuine multi-BH-domain protein that triggers apoptosis in the absence of Bax and Bak.
27076518 2016 Bok is a genuine multi-BH-domain protein that triggers apoptosis in the absence of Bax and Bak.
24806027 2014 Hypoxia-inducible regulation of placental BOK expression.
24113155 2013 Placental autophagy regulation by the BOK-MCL1 rheostat.
23884412 2013 The Bcl-2 protein family member Bok binds to the coupling domain of inositol 1,4,5-trisphosphate receptors and protects them from proteolytic cleavage.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
20673843 2010 Regulation of cell death in human fetal and adult ovaries--role of Bok and Bcl-X(L).
20171287 2010 Voxelwise genome-wide association study (vGWAS).
19942931 2010 Mtd/Bok takes a swing: proapoptotic Mtd/Bok regulates trophoblast cell proliferation during human placental development and in preeclampsia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19287972 2009 A natural antisense transcript, BOKAS, regulates the pro-apoptotic activity of human Bok.
19095301 2009 IFPA Trophoblast Research Award Lecture: the dynamic role of Bcl-2 family members in trophoblast cell fate.
16772296 2006 Bok, Bcl-2-related Ovarian Killer, Is Cell Cycle-regulated and Sensitizes to Stress-induced Apoptosis.
16302269 2006 Nuclear translocation of the pro-apoptotic Bcl-2 family member Bok induces apoptosis.
15868100 2005 Membrane translocation and oligomerization of hBok are triggered in response to apoptotic stimuli and Bnip3.
15775999 2005 A novel Mtd splice isoform is responsible for trophoblast cell death in pre-eclampsia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15102863 2004 BOK and NOXA are essential mediators of p53-dependent apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11034351 2000 Evolutionarily conserved Bok proteins in the Bcl-2 family.
10811653 2000 Drosophila pro-apoptotic Bcl-2/Bax homologue reveals evolutionary conservation of cell death mechanisms.
10579309 1999 Characterization of the antiapoptotic Bcl-2 family member myeloid cell leukemia-1 (Mcl-1) and the stimulation of its message by gonadotropins in the rat ovary.
9535847 1998 Mtd, a novel Bcl-2 family member activates apoptosis in the absence of heterodimerization with Bcl-2 and Bcl-XL.
9356461 1997 Bok is a pro-apoptotic Bcl-2 protein with restricted expression in reproductive tissues and heterodimerizes with selective anti-apoptotic Bcl-2 family members.