Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.76
PubTator Score 6.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.9e-05
sonic hedgehog group medulloblastoma 1482 2.6e-05
spina bifida 1064 4.2e-02
Disease Target Count Z-score Confidence
Myoma 12 3.37 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.500 2.6e-05
spina bifida -1.099 4.2e-02
ovarian cancer -1.400 1.9e-05

Gene RIF (3)

PMID Text
24157919 Bod1 regulates protein phosphatase 2A at mitotic kinetochores.
17938248 Bod1 is a novel kinetochore protein that is required for the detection or resolution of syntelic attachments in mitotic spindles.
17938248 siRNA depeletion of Fam44B (named Bod1 - Biorientation Defective 1 in this publication) resulted in persistent chromosome congression defects in metaphase.

AA Sequence

MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRR      1 - 70
DCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPK     71 - 140
LNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS                             141 - 185
//

Text Mined References (10)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24157919 2013 Bod1 regulates protein phosphatase 2A at mitotic kinetochores.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
17938248 2007 Bod1, a novel kinetochore protein required for chromosome biorientation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.