Property Summary

NCBI Gene PubMed Count 16
PubMed Score 45.89
PubTator Score 85.09

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (13)

Gene RIF (6)

PMID Text
20519495 Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20053908 Boc receptor is required for segregation of ipsilateral axons at the optic chiasm and, conversely, Boc expression in contralateral retinal ganglion cells prevents their axons from crossing the optic chiasm.
16647304 Cdo and Boc bind Shh through a high-affinity interaction with a specific fibronectin repeat that is essential for activity.
12720294 CDO and BOC play a role in differentiation of cells in the skeletal muscle lineage
11782431 BOC, along with CDO, defines a new subfamily of the immunoglobulin superfamily that is conserved from Drosophila to man. BOC and CDO form a putative receptor complex that stimulates differentiation of myoblasts.

AA Sequence

MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRL      1 - 70
NGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEV     71 - 140
DEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIMPSGNLQIVNASQEDEGMYKCAAYNPVTQEV    141 - 210
KTSGSSDRLRVRRSTAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFL    211 - 280
LSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNP    281 - 350
PPSVLWLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD    351 - 420
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSSPRTSKTDSYE    421 - 490
LVWRPRHEGSGRAPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLDPGSLYEVEMAAYNCAGEGQT    491 - 560
AMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDHGRLSPPEAPDRPTISTASETSVYVTWIPRG    561 - 630
NGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYV    631 - 700
VSGYSGRVYERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEG    701 - 770
DKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERP    771 - 840
VGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPSCPYTMVPLGG    841 - 910
LPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLLRQTHLGNGYD    911 - 980
PQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQRQEQPAAVGQSGVRRAPDSPVLEAVWDPPF    981 - 1050
HSGPPCCLGLVPVEEVDSPDSCQVSGGDWCPQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI         1051 - 1114
//

Text Mined References (20)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20519495 2010 All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20053908 2010 Segregation of ipsilateral retinal ganglion cell axons at the optic chiasm requires the Shh receptor Boc.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16647304 2006 The cell surface membrane proteins Cdo and Boc are components and targets of the Hedgehog signaling pathway and feedback network in mice.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15520228 2004 Netrins and neogenin promote myotube formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12720294 2003 Overexpression of the immunoglobulin superfamily members CDO and BOC enhances differentiation of the human rhabdomyosarcoma cell line RD.
12634428 2003 Promyogenic members of the Ig and cadherin families associate to positively regulate differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11782431 2002 BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.