Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.62
PubTator Score 6.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 2.800 1.7e-03
head and neck cancer and chronic obstruc... -1.100 4.0e-03
interstitial cystitis -1.400 9.9e-03
nasopharyngeal carcinoma -1.500 3.7e-04
periodontitis -1.100 6.9e-28
psoriasis 1.100 2.7e-03
spina bifida -2.026 4.6e-02
urothelial carcinoma -1.300 2.4e-03

Gene RIF (6)

AA Sequence

MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAG      1 - 70
TPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHE     71 - 140
FEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVLSHGGYHGD    141 - 210
GLNAVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRT    211 - 280
LDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRD    281 - 350
LHGSGGT                                                                   351 - 357
//

Text Mined References (13)

PMID Year Title