Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.68
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -2.000 3.6e-02
periodontitis -1.100 6.9e-28
interstitial cystitis -3.200 7.3e-05
nasopharyngeal carcinoma -1.500 3.7e-04
psoriasis 1.100 2.7e-03
spina bifida -2.026 4.6e-02
ductal carcinoma in situ 2.800 1.7e-03
head and neck cancer and chronic obstruc... -1.100 4.0e-03

Synonym

Accession Q7Z465 Q6DK43 Q8TCY7 Q8WYG2
Symbols BNIPS
PP753
BNIP-S
BNIPL1
BNIPL2
BNIPL-1
BNIPL-2
BNIP-Sbeta
BNIP-Salpha

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
16143817 p16INK4, IL-12, TRAIL & lymphotoxin beta gene involved in growth suppression or cell apoptosis were up-regulated & PTEN was down-regulated by BNIPL-1;suggests that it might inhibit cell growth though cell cycle arrest &/or apoptotic cell death pathway(s)
15112343 Data suggest that Bcl-2/adenovirus E1B 19 ku interacting protein 2-like (BNIPL-2) may regulate apoptosis through changes in the expression of genes associated with cell apoptosis, growth inhibition and cell proliferation.
12901880 BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.
12681488 interaction with cell proliferation-related proteins, MIF and GFER
11741952 These results indicate the presence of two BNIP-S splicing variants as cellular regulators and that the BCH domain of BNIP-Salpha confers a novel apoptotic function. The significance of this is discussed

AA Sequence

MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAG      1 - 70
TPSTLALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHE     71 - 140
FEWEDELPRAEGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVLSHGGYHGD    141 - 210
GLNAVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRT    211 - 280
LDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRD    281 - 350
LHGSGGT                                                                   351 - 357
//

Text Mined References (13)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16143817 2005 cDNA expression array analysis of gene expression in human hepatocarcinoma Hep3B cells induced by BNIPL-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15112343 2004 Differential gene expression in human hepatocellular carcinoma Hep3B cells induced by apoptosis-related gene BNIPL-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12901880 2003 BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.
12681488 2003 The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741952 2002 The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence.