Property Summary

NCBI Gene PubMed Count 133
PubMed Score 340.94
PubTator Score 187.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Protein-protein Interaction (4)

Gene RIF (104)

AA Sequence

MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNG      1 - 70
APGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQD     71 - 140
TNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSM    141 - 210
RNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF                         211 - 259
//

Text Mined References (137)

PMID Year Title