Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.42
PubTator Score 35.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12982 B4DS94
Symbols NIP2
BNIP-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (11)

PMID Text
25472445 BNIP-2 is a kinesin-1 adapter involved in vesicular transportation in the cytoplasm and that association with cargos depends on interaction of the CRAL-TRIO domain with membrane phosphatidylserine.
25378581 BNIP-2 directly interacted with the motor and tail domains of KIF5B via its BCH domain.
21130087 Data imply that SIRT1 may mediate MPP(+)-induced cytotoxicity, possibly through the regulation of BNIP2.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20704564 Inhibition of BNIP-2 expression did not affect the susceptibility to NK cell-mediated killing.
20677014 Observational study of gene-disease association. (HuGE Navigator)
17961507 Our results suggest that the caspase-mediated cleavage of BNIP-2 and BNIP-XL could result in the release of the BCH domain or smaller fragments that are crucial for their proapoptotic activities.
15652341 BNIP-2 in vivo induces cell dynamics by recruiting Cdc42
12944407 BNIP-2 has a role in regulating cell dynamics with a novel Rho GTPase-activating protein, BPGAP1
12901880 BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.
11744098 Transfection of the bnip2 cDNA in neuroblastoma cell line results in massive cell death counteracted by Bcl-2 overexpression; bnip2 is the mediator of the anti-apoptotic activity of estrogens in a variety of cells

AA Sequence

MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVL      1 - 70
SDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDH     71 - 140
RVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVY    141 - 210
LNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAE    211 - 280
LAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ                                        281 - 314
//

Text Mined References (33)

PMID Year Title
25472445 2015 BNIP-2 binds phosphatidylserine, localizes to vesicles, and is transported by kinesin-1.
25416956 2014 A proteome-scale map of the human interactome network.
25378581 2015 KIF5B transports BNIP-2 to regulate p38 mitogen-activated protein kinase activation and myoblast differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21130087 2011 SIRT1 deficiency attenuates MPP+-induced apoptosis in dopaminergic cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20704564 2010 Identification of the BCL2/adenovirus E1B-19K protein-interacting protein 2 (BNIP-2) as a granzyme B target during human natural killer cell-mediated killing.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17961507 2007 Cleavage of BNIP-2 and BNIP-XL by caspases.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15652341 2005 BNIP-2 induces cell elongation and membrane protrusions by interacting with Cdc42 via a unique Cdc42-binding motif within its BNIP-2 and Cdc42GAP homology domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12944407 2003 Concerted regulation of cell dynamics by BNIP-2 and Cdc42GAP homology/Sec14p-like, proline-rich, and GTPase-activating protein domains of a novel Rho GTPase-activating protein, BPGAP1.
12901880 2003 BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741952 2002 The BNIP-2 and Cdc42GAP homology/Sec14p-like domain of BNIP-Salpha is a novel apoptosis-inducing sequence.
10954711 2000 The BNIP-2 and Cdc42GAP homology domain of BNIP-2 mediates its homophilic association and heterophilic interaction with Cdc42GAP.
10799524 2000 Evidence for a novel Cdc42GAP domain at the carboxyl terminus of BNIP-2.
10551883 1999 Tyrosine phosphorylation of the Bcl-2-associated protein BNIP-2 by fibroblast growth factor receptor-1 prevents its binding to Cdc42GAP and Cdc42.
10381623 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region.
7954800 1994 Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins.