Property Summary

NCBI Gene PubMed Count 209
PubMed Score 415.25
PubTator Score 624.08

Knowledge Summary

Patent (17,055)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gout 93 0.0 1.0
Disease Target Count Z-score Confidence
Pulmonary venoocclusive disease 3 0.0 5.0
Disease Target Count
Pulmonary hypertension, primary, 1 1

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.100 5.5e-03
malignant mesothelioma -1.200 3.2e-05
osteosarcoma 4.807 2.6e-10
chronic lymphosyte leukemia 1.600 3.8e-08
atypical teratoid / rhabdoid tumor -1.300 5.1e-04
glioblastoma -1.100 2.3e-04
medulloblastoma, large-cell -1.300 2.7e-03
primary pancreatic ductal adenocarcinoma 2.597 5.9e-05
Breast cancer 3.600 2.5e-02
lung adenocarcinoma -1.200 1.4e-10
adult high grade glioma -1.100 3.1e-03
aldosterone-producing adenoma -1.453 6.9e-03
acute myeloid leukemia -1.800 2.4e-02
ovarian cancer 1.900 4.2e-03
pancreatic cancer 2.500 3.0e-04

 GWAS Trait (1)

Protein-protein Interaction (11)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (174)

PMID Text
26772960 establish the feasibility of combining NELL-1 with BMP2 to improve clinical bone regeneration and provide mechanistic insight into canonical Wnt pathway activity during NELL-1 and BMP2 osteogenesis
26739752 the data in the present study support the notion that the expression levels and plasma membrane levels of BMPRII are determined by two molecular processes-translational regulation of protein synthesis (which provides the major contribution) and endocytosis/degradation (mild modulatory effect).
26589479 Raf family members and ERK1/2 were constitutively activated after BMPR2 knockdown
26541523 In a group of pulmonary arterial hypertension patients, 25.4% harboured heterozygous mutation in the BMPR2 gene.
26406943 An up-regulated expression of BMP-4 and BMPR-II was observed in the peripheral blood of breast cancer patients especially in the advanced-stage of the disease. Moreover, BMP-4 and BMPR-II expressions were found to be correlated
26167679 study shows for the first time that in the regulatory region of the BMPR2 gene the promoter may be important for pulmonary arterial hypertension penetrance
26151470 miR-153 is a mechano-sensitive miRNA that regulates osteoblast differentiation by directly targeting BMPR2, and that therapeutic inhibition of miR-153 may be an efficient anabolic strategy for skeletal disorders caused by pathological mechanical loading.
26076038 BMP9 is identified as the preferred ligand for preventing apoptosis and enhancing monolayer integrity in endothelial cells from subjects with pulmonary arterial hypertension who bear mutations in the gene encoding BMPR2.
26030479 Mutations in BMPR2 underlie most heritable cases and a small proportion of sporadic cases of idiopathic pulmonary arterial hypertension. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201408-1528OC#.Viqgi9KFPyA
25755766 our results showed that GDF-5 and BMPRII expressed both in normal and degenerated intervertebral disc tissues, and GDF-5 might have an inhibition effect on degenerated lumbar intervertebral discs
25723654 local gene transfection can up-regulate the expression of osteogenic mediators (BMP-2 and TGF-beta1), which may promote cell differentiation and proliferation and stimulate extracellular matrix synthesis and new bone formation in distraction gap.
25698539 Correlations between C23, BMPRII expression and prognosis of gastric cancer patients.
25688877 disrupted intracellular trafficking of BMPR2 is involved in the pathogenic mechanism underlying both cysteine and non-cysteine substitutions occurring in the extracellular ligand binding domain and kinase domain of BMPR2.
25612240 Combining mutation detection in family members with parental identification, study described three cases of de novo mutation in the BMPR2 gene by different modes in a pulmonary arterial hypertension family. These de novo mutations may account for the wide variety of mutations in BMPR2.
25501832 Silencing BMPR2 promoted G2/M cell cycle arrest and apoptosis through caspase-3-dependent pathway via repression of XIAP and induced autophagy of chondrosarcoma cells via XIAP-Mdm2-p53 pathway.
25447587 BMP2 decreased serum-induced proliferation and increased the pro-apoptotic Bax/Bcl-2 ratio. These effects were attenuated by endothelin-1 pre-treatment
25429696 Mutations in BMPR2 encoding bone morphogenetic protein receptor type 2 (BMPRII) is the main genetic risk factor for heritable pulmonary arterial hypertension
25187962 The BMPR2 protein containing Thr268fs, Ser863Asn, or Gln433X exhibited abnormal subcellular localization.
25075125 BMP type II receptors, BMPR2 and ActR2a, have redundant roles in the regulation of hepatic hepcidin gene expression and iron metabolism.
24936649 Mutations in BMPR2 gene is associated with pulmonary arterial hypertension.
24881940 BMPR-2 mutation-positive patient developed pulmonary AVMs reminiscent of HHT.
24814649 BMP-2 and -4 are produced by vascular smooth muscle cells in atherosclerotic lesions and induce monocyte chemotaxis through direct BMPRII activation
24728306 Case Report: BMPR2 missense mutation in chronic thromboembolic pulmonary hypertension.
24621962 a new intronic BMPR2-mutation and early diagnosis of heritable pulmonary arterial hypertension
24605778 Mutations of BMPR2 have been linked to pulmonary arterial hypertension (PAH). In a case-control study unaffected carriers of this mutation were most often found to have prostacyclin synthase promoter sequence variants, thought to protect against PAH.
24591673 Letter/Case Report: concurrent pulmonary hypertension and pulmonary fibrosis in BMPR2 mutation positive patient.
24583436 patient is currently an asymptomatic carrier of the BMPR2 mutation, and that he might develop pulmonary hypertension as a result of this mutation in the future.
24446489 loss of BMPR2 induced prolonged phospho-p38 MAPK in response to TNF, and this increased GADD34-PP1 phosphatase activity, dephosphorylating eukaryotic translation initiation factor (eIF2alpha), and derepressing GM-CSF mRNA translation
24398041 BMPR1a and BMPR2 are downregulated in cardiac remodeling and heart failure
24378993 BMPR2 downregulation is mediated by miR-17-92.
24355637 In this review, the identification of BMPR2 as the major predisposing gene for pulmonary arterial hypertension is investigated.
24337809 Site-directed mutagenesis reveals that BMPR2 is uniquely glycosylated near its ligand binding domain and at a position that is mutated in patients with heritable pulmonary arterial hypertension.
24274756 Impaired right ventricle (RV) hypertrophy was associated with triglyceride deposition in mice with mutant Bmpr2 expression in RV. Human RVs with heritable pulmonary arterial hypertension showed lipid deposition and alteration in fatty acid oxidation.
24194909 A BMPR2 mutation did not correlate with a greater incidence of hemoptysis in a hypertension cohort, but its association with worse hemodynamics and greater bronchial arterial hypertrophy may increase the risk of hemoptysis.
24132125 A 25-year-old female PAH patient with a deletion of BMPR2 exon 3.
24036241 BMPR2 mutations may have a role in diffusion capacity and in pulmonary arterial hypertension
24008158 Simultaneous exposure of pulmonary smooth muscle cells to viral protein(s) and cocaine exacerbates downregulation of BMPR axis that may result in enhanced pulmonary vasculature aberrations in HIV positive drug users.
24008158 Treatment of pulmonary arterial smooth muscle cells with HIV-1 gp120 downregulates expression of BMPR-2, BMPR-1A, and BMPR-1B proteins
23967299 Endoglin-mediated suppression of prostate cancer invasion is regulated by activin and bone morphogenetic protein type II receptors.
23843612 Critical roles of Bmp2 in osteoblasts and MSCs are a vital link between bone formation, vascularization and mesenchymal stem cells.
23675998 The 5-year survival rate after diagnosis of pulmonary arterial hypertension was 88.5% in BMPR2 mutation carriers versus 80.9% in non-carriers in Japanese.
23579436 Exonic deletions of BMPR2 account for at least part of BMPR2 mutations associated with heritable pulmonary arterial hypertension in Japan, as reported in other populations.
23142694 ALK2 may be an important receptor in ET-1 production during BMPR2 knockdown
23115311 BMPR2 carriers had an enhanced hypoxic pressure response when expressed as PVR versus arterial oxygen saturation measured by pulse oximetry
23098893 In conclusion, there was no BMPR2 mutation in our cohort study, but 5'UTR repeat polymorphisms in BMPR2 were disclosed with three genetics variations.
23079343 these results further supports the role of the atlastin-1 of BMP signaling cascade in axonal maintenance and axonal degeneration, which is seen in various types of hereditary spastic paraplegia.
22988237 the negative regulatory loop of BMP4-miR-302-BMPRII is a potential mechanism for the maintenance and fine-tuning of the BMP4 signaling pathway in various systems
22961979 the lateral mobility of BMPRI has a major impact in stabilizing heteromeric BMPRI-BMPRII receptor complexes to differentially stimulate SMAD versus non-SMAD signaling.
22923661 Study casts doubt on the genetic anticipation of heritable pulmonary hypertenion related to mutations in BMPR2. The risk of earlier disease does not appear to be passed on to the next generations.
22923421 BMPR2 mutation carriers was higher mPAP, mRVP, and PVR values with significantly greater hemodynamic compromise.
22894880 This study has identified regions of the BMPR-II molecule that define ligand specificity.
22684006 miR-100 plays a negative role in osteogenic differentiation and might act through targeting BMPR2
22632830 Patients with childhood idiopathic pulmonary arterial hypertension or heritable pulmonary arterial hypertension with BMPR2 mutation have the poorest clinical outcomes.
22341419 Report significant reduction in BMPR2 expression in pulmonary arteries of patients with failed Fontan circulations.
22312021 study concludes that expression of pulmonary arterial hypertension penetrance signature represents increased risk of developing clinical hereditary pulmonary arterial hypertension (HPAH) and that ROS formation may play a role in pathogenesis of HPAH; results provide molecular insight into NMD BMPR2 related HPAH penetrance
22293501 generation of TGF-beta and BMP receptor homo- and hetero-oligomers and its roles as a mechanism capable of fast regulation of signaling by these crucial cytokines [review]
22129439 Mutations in BMPR2 are not involved in the pathogenesis of idiopathic portal hypertension.
22048752 There are no differences of Stro-1(+) cells, BMPRs(+) cells, and BMP7 concentration between male and female patients with total hip replacement.
21962132 Variation in BMPR2 is associated with dizygotic twinning.
21898662 These results demonstrate the role of BMPR2 mutation in the pathogenesis of PAH and indicate that variation within the SMAD family represents an infrequent cause of the disease.
21821917 Data describe a BMPR2-mediated transcriptional complex between PPARgamma and beta-catenin, and suggest that apelin could be effective in treating PAH by rescuing BMPR2 and PAEC dysfunction.
21808054 Stimulation of BMPRII promotes normal pulmonary artery endothelial cell function by activating eNOS.
21801371 Identify new BMPR2 mutations in pulmonary arterial hypertension associated with younger age at diagnosis and more severe hemodynamic compromise.
21622843 Three BMPR2 mutants decreased BMP-dependent Smad phosphorylation and Smad signaling. New treatment options for PAH should also target receptor localization, rather than just expression level.
21311592 Combined BMPR2 genotype-phenotype-mRNA expression data as well as evolutionary aspects suggest a role of BMPR2 in the pathophysiology of obesity.
21152263 BMPR2 were detected in the human retina and retinoblastoma cell lines.
21070126 The researchers found evidence that polymorphisms in the BMPR2 gene are overrepresented in patients with atrial septal heart defects and exercise-associated pulmonary hypertension.
21070126 Observational study of gene-disease association. (HuGE Navigator)
21030519 BMPR-II mutations in heritable pulmonary arterial hypertension characterized by retention within the endoplasmic reticulum; restoration of cell surface expression of ligand-binding domain mutants leads to partial rescue of BMP signaling
20955454 Data indicate that frameshift mutation of BMPR2 gene occurs in GC and CRC with MSI-H, and suggest that the BMPR2 mutation might contribute to cancer pathogenesis by inactivating BMPR2-mediated BMP signaling.
20955454 Observational study of gene-disease association. (HuGE Navigator)
20870717 Expression of BMPR-II protein is constitutively regulated by lysosomal degradation in vascular cells.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20587070 Low BMPR2 is associated with epithelial ovarian cancer.
20534176 Pulmonary hypertensive BMPR2 mutation carriers are younger at diagnosis and present with a more severe hemodynamic compromise, irrespective of gender and mutation type.
20534176 Observational study of gene-disease association. (HuGE Navigator)
20410205 Data support cross-regulation among BMP2, KLF9, and KLF13 to maintain progesterone sensitivity in stromal cells undergoing differentiation and suggest that loss of this network compromises establishment of uterine receptivity and implantation success.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20096498 Mutations of the gene that code bone morphogenic protein type 2 receptor (BMPR2) are involved in the pathogenesis of pulmonary arterial hypertension both in it familial and its idiopathic forms.
20096498 Observational study of gene-disease association. (HuGE Navigator)
20011660 The coordinated activity of ActRIIA and BMPRII receptor subunits selectively mediates the chemotactic response to BMP7.
20002458 study established the frequency of BMPR2 mutations in Chinese population of pulmonary arterial hypertension patients
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864167 the 3q22 locus alone predicts most FPAH cases in BMPR2 mutation carriers, providing strong evidence that BMPR2 and the 3q22 locus interact epistatically
19844076 no mutations associated with late-onset sporadic pulmonary hypertension
19844076 Observational study of gene-disease association. (HuGE Navigator)
19782107 the inhibition of apoptosis by BMP2 and GDF5 does not depend on more complex signal transduction pathways such as smad and MAPK signaling but on direct stabilization of XIAP by BMPR2.
19634078 Germline mutations in the gene coding bone morphogenetic receptor type 2 (BMPR2) are detectable in the majority of cases of heritable pulmonary arterial hypertension and in a small proportion of cases of idiopathic pulmonary arterial hypertension [review]
19628780 late-outgrowth cells isolated from pulmonary arterial hypertension patients with BMPRII(bone morphogenetic protein receptor type II) mutations demonstrated clear differences in angiogenic capacity and proliferation in response to serum
19578724 miR-21 may have a potential role in regulating the malignancy and metastatic abilities of prostate cancer cells and in self-renewal of stem cells by regulating the expression of bone morphogenetic protein receptor II
19552837 BMPR2 promoter mutation -142G > A may be associated with familial pulmonary arterial hypertension.
19531247 Copy-number variation in intron 1 in BMPR2 is unlikely to play a role in the pathogenesis of either familial or sporadic pulmonary arterial hypertension
19531247 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19424179 cGKI has a dual function in BMP signalling: (1) it modulates BMP receptor/Smad activity at the plasma membrane and (2) after redistribution to the nucleus, it further regulates transcription as a nuclear co-factor for Smads.
19390056 Interleukin-6 modulates the expression of the bone morphogenic protein receptor type II through a novel STAT3-microRNA cluster 17/92 pathway.
19357154 a BMPR2 mutation may have a role in pulmonary arterial hypertension in females
19357154 Observational study of gene-disease association. (HuGE Navigator)
19324947 BMPR-2 mutations are associated with defective Smad signalling compensated for by an activation of p38MAPK signalling, accounting for PASMC proliferation and deficient apoptosis in pulmonary hypertension
19307479 Pulmonary hypertensive response to exercise and hypoxia in idiopathic/familial PAH relatives appears as a genetic trait with familial clustering, being correlated to but not caused by a BMPR2 mutation
19307479 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223935 Novel promoter and exon mutations of the BMPR2 gene in pulmonary arterial hypertension.
19206171 Fndings suggest that the levels of expression of WT BMPR2 allele transcripts is important in the pathogenesis of FPAH caused by NMD1 mutations.
19195606 AVICs isolated from stenotic valves had greater expression of TLR2 and TLR4 and a greater BMP-2 response than AVICs from normal valves
19059957 the majority of familial cases of PAH disease are due to mutations in transforming growth factor (TGF)-beta superfamily receptor, bone morphogenetic protein receptor,type II; and potential therapeutic approaches aimed at rescuing this signaling pathway
19051722 Because only 10-20% carriers with BMPR2 mutations develop PAH, the existence of environmental factors or modifier genes as 5-HTT(serotonin transporter) and ACE (angiotensin converting enzyme) is highly probable.
18792970 BMPR2 mutation in a patient with pulmonary arterial hypertension and suspected hereditary hemorrhagic telangiectasia is reported.
18647753 failure of bone morphogenetic protein receptor trafficking in pulmonary arterial hypertension
18621057 Results showed that type II receptors, such as BMP receptor II, activin receptor IIA, and activin receptor IIB, competed with the pd for binding to the growth factor and displaced the prodomain from the complex.
18503968 Patients with BMPR2 mutations are less likely to respond to acute vasodilator testing than mutation-negative patients and appear to have more severe disease at diagnosis.
18496036 The TGFbeta1 SNPs studied modulate age at diagnosis and penetrance of familial pulmonary arterial hypertension in BMPR2 mutation heterozygotes.
18496036 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18436795 both BMP type II receptor mutation and Id1 knockdown leads to loss of growth suppression by BMPs
18364108 the Glu386Val mutation and its absence in healthy controls support the mutation as the cause of familial pulmonary hypertension.
18356561 BMPR2 mutation carriers with PAH present approximately 10 years earlier than noncarriers with more severe hemodynamic compromise at diagnosis.
18356561 Observational study of gene-disease association. (HuGE Navigator)
18342887 The objective of this study was to determine ligand-binding epitopes and specificity determinants in two regions, the hydrophobic patch and the A-loop of the BMPR-II extracellular domain.
18321866 Stoichiometric imbalance, due to either haplo-insufficiency or loss of optimal receptor-receptor interactions impairs BMPR-II mediated signalling in pulmonary arterial hypertension.
18292470 there was significant down-regulation of BMPRII (bone morphogenetic protein receptor type II) expression in asthma patients at baseline
18221724 The presence of mutations in the gene encoding BMPR2 is not infrequent in patients with idiopathic PAH, suggesting that this family of growth factors may be important in the pathogenesis of the disease
18187665 Observational study of gene-disease association. (HuGE Navigator)
18159113 ALK1 plays as notable a role as BMPR2 in the etiology of PAH. Asymptomatic carriers with the ALK1 mutation within the serine - threonine kinase domain are at risk of developing PAH and hereditary hemorrhagic telangiectasia
17700526 Conditional inactivation of BMP type II receptor (BMPRII) in the stroma leads to epithelial hyperplasia throughout the colon with increased epithelial cell proliferation.
17641158 These results demonstrate that the 5'-untranslated region of BMPR2 is considerably longer than previously thought; we identified a double-substitution mutation
17624341 Expression of BMP-4 and BMP-7 and their receptors in human ovaries from fetuses as well as adults.
17576816 Trb3 is a critical component of a novel mechanism for regulation of the bone morphogenetic protein pathway by BMPRII.
17515463 primary pulmonary arterial smooth muscle cells demonstrated colocalization of BMPRII and RACK1 in vivo. RACK1-BMPRII interaction was reduced when kinase domain mutations occurring in patients with PAH were introduced to BMPRII
17472960 RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and that increased utilization of ActRIIA leads to generation of an enhanced BMP signal
17363346 negligible change in the emission maximum was observed when bis-ANS binds ecBMPR-II. FRET revealed close proximity between tryptophan residue & bis-ANS binding site.
17322283 BMP pathway regulates IL-6 in pulmonary tissues and conversely that IL-6 regulates the BMP pathway
17318011 Germline mutations in the gene coding for the bone morphogenetic protein receptor II (BMPR2) are present in more than 70% of FPAH and up to 26% of idiopathic, apparently sporadic cases (IPAH).
17277049 This protein, in transgenic rats, provide a rationale for the development of gene therapy aimed at improving BMPR2 signaling.
17203235 HGF up-regulates the expression of the bone morphogenetic protein receptors, BMPR-IB and BMPR-II, in prostate cancer cells
17102831 Atrial septal defect Eisenmenger syndrome may occur without BMPR2 mutation.
16982201 Characterization of this enzyme expressed in E coli cells.
16782755 Novel signaling network relevant to pulmonary artery hypertension underscored by BMPR2 mutations.
16717148 Observational study of gene-disease association. (HuGE Navigator)
16717148 Patients with familial or idiopathic PAH and nonsynonymous BMPR2 variations are unlikely to demonstrate vasoreactivity
16615932 Finally, two inhibitors of cyclin-dependent kinase 9 (a dominant negative CDK9 and flavopiridol) repressed activity from the MR and BMPR2 promoters
16615932 Treatment of pulmonary arterial smooth muscle cells with HIV-1 gp120 downregulates expression of BMPR-2, BMPR-1A, and BMPR-1B proteins
16436528 Human granulosa-like tumor cell line KGN expressed BMP type I (BMPR1A and BMPR1B) and type II receptors (BMPR2) and the BMP signaling molecules SMADs (SMAD1 and SMAD5).
16429403 BMPR2 gene rearrangements have a role in mutations in familial and idiopathic pulmonary arterial hypertension
16429395 TGF-beta type II receptor BMPR2 is mutated in pulmonary arterial hypertension
16339917 The correlation of the SERT promoter polymorphism with age at diagnosis in FPAH suggests a possible relationship between the SERT and BMPR2.
16339782 Bone morphogenetic protein regulaates K(V) channel expression and that loss of this signaling pathway in pulmonary artery through a mutation in BMPR2.
16282533 Treatment of pulmonary arterial smooth muscle cells with HIV-1 gp120 downregulates expression of BMPR-2, BMPR-1A, and BMPR-1B proteins
16155937 Our data suggest that the complex formation between c-kit and BMPR-II leads to phosphorylation of BMPR-II at Ser757, which modulates BMPR-II-dependent signaling
16122479 Bone morphogenetic protein-2 is the predominant family member expressed in NSCLC and is overexpressed in the majority of human lung carcinomas independent of cell type.
16002577 c-Src tyrosine kinase was identified as a binding partner of the BMPR-II C-terminus.
15965979 Observational study of genotype prevalence. (HuGE Navigator)
15965979 BMPR2 mutations have a role in short lifetime expectancy in primary pulmonary hypertension
15775752 BMPR2 gene rearrangements is associated with primary pulmonary hypertension
15699281 Somatic loss of wild-type BMPR2 alleles is unlikely to play a significant role in the pathogenesis of familial pulmonary arterial hypertension.
15687131 2 novel mutations were found in BMPR2 from 18 patients developing PAH before 6 years of age, including one partial gene deletion and one nonsense mutation.
15591269 frequency of BMPR2 mutations in a different population of patients with sporadic idiopathic pulmonary arterial hypertension
15516492 Mutations may promote expansion of fibroblasts resistant to antiproliferative, prodifferentiation effects of bone morphogenetic proteins. Possible mechanism for vascular obliteration in familial pulmonary hypertension.
15492256 Human bladder TCC tissues have a frequent loss of BMP-RII expression and that overexpression of BMP-RII leads to restoration of BMP signaling and decreased tumor growth in the human bladder TCC cell line TSU-Pr1.
15358693 Observational study of gene-disease association. (HuGE Navigator)
15354178 Loss of BMP-RII function may result in increased tumorigenicity in human prostate cancer cells.
15295086 Pulmonary hypertension in children may have a different genetic background than in adults and we postulate a recessive mode of inheritance in a proportion of infantile cases.
15235019 Observational study of genotype prevalence. (HuGE Navigator)
15146475 results indicate that a substantial portion of Japanese primary pulmonary hypertension patients carry BMPR2 mutations with considerable heterogeneity
15055271 Mutations of BMPR2 underlie many cases of familial primary pulmonary hypertension.
15031260 Loss of BMPRII signaling in mouse smooth muscle (due to dominant negative human transgene)is sufficient to produce the pulmonary hypertensive phenotype.
14676131 Decreased expression of bone morphogenetic protein (BMP) receptor type II correlates with insensitivity to BMP-6 in human renal cell carcinoma cells
12543773 Overexpression of a dominant negative type II bone morphogenetic protein receptor inhibits the growth of human breast cancer cells.
12415595 Observational study of gene-disease association. (HuGE Navigator)
12358323 Observational study of gene-environment interaction. (HuGE Navigator)
12358323 bone morphogenetic protein receptor 2 mutations that appear to be rare in the general population but may combine with exposure to fenfluramine derivatives to greatly increase the risk of developing severe pulmonary arterial hypertension
12221115 BMPRII has a role in signal transduction and its mutation can lead to primary pulmonary hopertension
12135884 Bone morphogenetic protein receptor type II is a receptor for growth differentiation factor-9
11714695 signals induced by binding of BMP-2 to preformed receptor complexes activate the Smad pathway, whereas BMP-2-induced recruitment of receptors activates a different, Smad-independent pathway

AA Sequence

MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLW      1 - 70
EKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLS     71 - 140
PPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIG    141 - 210
RGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVME    211 - 280
YYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVIS    281 - 350
DFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC    351 - 420
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEA    421 - 490
RLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTD    491 - 560
SIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTIS    561 - 630
EMPYPDETNLHTTNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLS    631 - 700
STSSSLLYPLIKLAVEATGQQDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPR    701 - 770
LKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT    771 - 840
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPC    841 - 910
SEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGESTQDGKSGSGEKIKKRVKTPYS    911 - 980
LKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLAEGGTATTMVSKDIGMNCL                981 - 1038
//

Text Mined References (215)

PMID Year Title
27273094 2016 BMP signaling turns up in fragile X syndrome: FMRP represses BMPR2.
26772960 2016 Novel Wnt Regulator NEL-Like Molecule-1 Antagonizes Adipogenesis and Augments Osteogenesis Induced by Bone Morphogenetic Protein 2.
26739752 2016 Differential regulation of translation and endocytosis of alternatively spliced forms of the type II bone morphogenetic protein (BMP) receptor.
26690041 2016 Structural insights into BMP receptors: Specificity, activation and inhibition.
26589479 2016 Raf/ERK drives the proliferative and invasive phenotype of BMPR2-silenced pulmonary artery endothelial cells.
26541523 2015 Occupational exposure to organic solvents: a risk factor for pulmonary veno-occlusive disease.
26406943 2015 Transcriptional up-regulation of BMP-4 and BMPR-II genes in the peripheral blood of breast cancer patients: A pilot study.
26373550 2015 BMPR2 spruces up the endothelium in pulmonary hypertension.
26167679 2015 Mutation in BMPR2 Promoter: A 'Second Hit' for Manifestation of Pulmonary Arterial Hypertension?
26151470 2015 MicroRNA-153 suppresses the osteogenic differentiation of human mesenchymal stem cells by targeting bone morphogenetic protein receptor type II.
26076038 2015 Selective enhancement of endothelial BMPR-II with BMP9 reverses pulmonary arterial hypertension.
26030479 2015 RNA Sequencing Analysis Detection of a Novel Pathway of Endothelial Dysfunction in Pulmonary Arterial Hypertension.
25755766 2015 Role of growth differentiation factor-5 and bone morphogenetic protein type II receptor in the development of lumbar intervertebral disc degeneration.
25723654 2015 Gene expression of osteogenic factors following gene therapy in mandibular lengthening.
25698539 2015 C23 protein meditates bone morphogenetic protein-2-mediated EMT via up-regulation of Erk1/2 and Akt in gastric cancer.
25688877 2015 Defective cellular trafficking of the bone morphogenetic protein receptor type II by mutations underlying familial pulmonary arterial hypertension.
25612240 2015 De novo mutations in the BMPR2 gene in patients with heritable pulmonary arterial hypertension.
25501832 2014 BMPR2 inhibition induced apoptosis and autophagy via destabilization of XIAP in human chondrosarcoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25447587 2015 Endothelin-Bone morphogenetic protein type 2 receptor interaction induces pulmonary artery smooth muscle cell hyperplasia in pulmonary arterial hypertension.
25429696 2015 Characteristics of pulmonary arterial hypertension in affected carriers of a mutation located in the cytoplasmic tail of bone morphogenetic protein receptor type 2.
25187962 2014 Functional changes in pulmonary arterial endothelial cells associated with BMPR2 mutations.
25159282 2014 Genetics of pulmonary hypertension.
25075125 2014 BMP type II receptors have redundant roles in the regulation of hepatic hepcidin gene expression and iron metabolism.
24936649 2014 Novel mutations in BMPR2, ACVRL1 and KCNA5 genes and hemodynamic parameters in patients with pulmonary arterial hypertension.
24881940 2014 Better off blue: BMPR-2 mutation, arteriovenous malformation, and pulmonary arterial hypertension.
24814649 2014 BMP-2 and -4 produced by vascular smooth muscle cells from atherosclerotic lesions induce monocyte chemotaxis through direct BMPRII activation.
24728306 2014 BMPR2 germline mutation in chronic thromboembolic pulmonary hypertension.
24621962 2014 Identification of a new intronic BMPR2-mutation and early diagnosis of heritable pulmonary arterial hypertension in a large family with mean clinical follow-up of 12 years.
24605778 2014 Functional prostacyclin synthase promoter polymorphisms. Impact in pulmonary arterial hypertension.
24591673 2014 Pulmonary arterial hypertension preceding idiopathic pulmonary fibrosis in a BMPR2 mutation positive patient.
24583436 2014 An anomalous unilateral single pulmonary vein associated with a bone morphogenetic protein receptor II gene mutation.
24446489 2014 Reduced BMPR2 expression induces GM-CSF translation and macrophage recruitment in humans and mice to exacerbate pulmonary hypertension.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24398041 2014 Expression of bone morphogenetic protein 4 and its receptors in the remodeling heart.
24378993 2014 Crosstalk between TGF-?/Smad3 and BMP/BMPR2 signaling pathways via miR-17-92 cluster in carotid artery restenosis.
24355637 2013 Genetics and genomics of pulmonary arterial hypertension.
24337809 2014 N-linked glycosylation of the bone morphogenetic protein receptor type 2 (BMPR2) enhances ligand binding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24274756 2014 Evidence for right ventricular lipotoxicity in heritable pulmonary arterial hypertension.
24194909 2013 Risk factors for hemoptysis in idiopathic and hereditary pulmonary arterial hypertension.
24132125 2013 A novel break point of the BMPR2 gene exonic deletion in a patient with pulmonary arterial hypertension.
24078385 2013 Genetics and the molecular pathogenesis of pulmonary arterial hypertension.
24036241 2014 Diffusion capacity and BMPR2 mutations in pulmonary arterial hypertension.
24008158 2013 Downregulation of bone morphogenetic protein receptor axis during HIV-1 and cocaine-mediated pulmonary smooth muscle hyperplasia: implications for HIV-related pulmonary arterial hypertension.
23967299 2013 Endoglin-mediated suppression of prostate cancer invasion is regulated by activin and bone morphogenetic protein type II receptors.
23843612 2013 Bmp2 in osteoblasts of periosteum and trabecular bone links bone formation to vascularization and mesenchymal stem cells.
23675998 2013 Bone morphogenetic protein receptor type 2 mutations, clinical phenotypes and outcomes of Japanese patients with sporadic or familial pulmonary hypertension.
23579436 2013 Alu-mediated nonallelic homologous and nonhomologous recombination in the BMPR2 gene in heritable pulmonary arterial hypertension.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23142694 2013 ALK2 and BMPR2 knockdown and endothelin-1 production by pulmonary microvascular endothelial cells.
23115311 2012 Echocardiography of pulmonary vascular function in asymptomatic carriers of BMPR2 mutations.
23098893 2013 5'UTR repeat polymorphisms of the BMPR2 gene in children with pulmonary hypertension associated with congenital heart disease.
23079343 2013 Hereditary spastic paraplegia-causing mutations in atlastin-1 interfere with BMPRII trafficking.
22988237 2012 Inhibition of microRNA-302 (miR-302) by bone morphogenetic protein 4 (BMP4) facilitates the BMP signaling pathway.
22961979 2012 SMAD versus non-SMAD signaling is determined by lateral mobility of bone morphogenetic protein (BMP) receptors.
22923661 2012 Longitudinal analysis casts doubt on the presence of genetic anticipation in heritable pulmonary arterial hypertension.
22923421 2012 BMPR2 mutations influence phenotype more obviously in male patients with pulmonary arterial hypertension.
22894880 2012 A host-guest relationship in bone morphogenetic protein receptor-II defines specificity in ligand-receptor recognition.
22684006 2012 MicroRNA-100 regulates osteogenic differentiation of human adipose-derived mesenchymal stem cells by targeting BMPR2.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22632830 2012 Outcomes of childhood pulmonary arterial hypertension in BMPR2 and ALK1 mutation carriers.
22341419 2012 Attenuation of bone morphogenetic protein receptor type 2 expression in the pulmonary arteries of patients with failed Fontan circulation.
22312021 2012 Connectivity map analysis of nonsense-mediated decay-positive BMPR2-related hereditary pulmonary arterial hypertension provides insights into disease penetrance.
22293501 2012 Oligomeric interactions of TGF-? and BMP receptors.
22129439 2012 Bone morphogenetic protein receptor 2 in patients with idiopathic portal hypertension.
22048752 2012 Impacts of age and gender on bone marrow profiles of BMP7, BMPRs and Stro-1? cells in patients with total hip replacement.
21976273 2012 New insights into the molecular mechanism of multiple synostoses syndrome (SYNS): mutation within the GDF5 knuckle epitope causes noggin-resistance.
21962132 2011 Variation in BMPR1B, TGFRB1 and BMPR2 and control of dizygotic twinning.
21898662 2011 Molecular genetic characterization of SMAD signaling molecules in pulmonary arterial hypertension.
21821917 2011 Disruption of PPAR?/?-catenin-mediated regulation of apelin impairs BMP-induced mouse and human pulmonary arterial EC survival.
21808054 2011 Bone morphogenetic protein receptor II is a novel mediator of endothelial nitric-oxide synthase activation.
21801371 2011 Hemodynamic and clinical onset in patients with hereditary pulmonary arterial hypertension and BMPR2 mutations.
21622843 2011 Trapping of BMP receptors in distinct membrane domains inhibits their function in pulmonary arterial hypertension.
21311592 2011 Genetic and evolutionary analyses of the human bone morphogenetic protein receptor 2 (BMPR2) in the pathophysiology of obesity.
21152263 2010 Bone morphogenetic protein 4 (BMP4) signaling in retinoblastoma cells.
21070126 2010 A novel BMPR2 gene mutation associated with exercise-induced pulmonary hypertension in septal defects.
21030519 2010 Bone morphogenetic protein type II receptor mutations causing protein misfolding in heritable pulmonary arterial hypertension.
20955454 2010 Somatic frameshift mutations of bone morphogenic protein receptor 2 gene in gastric and colorectal cancers with microsatellite instability.
20870717 2010 Identification of a lysosomal pathway regulating degradation of the bone morphogenetic protein receptor type II.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20587070 2010 Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients.
20534176 2010 Absence of influence of gender and BMPR2 mutation type on clinical phenotypes of pulmonary arterial hypertension.
20410205 2010 Functional differentiation of uterine stromal cells involves cross-regulation between bone morphogenetic protein 2 and Kruppel-like factor (KLF) family members KLF9 and KLF13.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20096498 2010 [Study of the BMPR2 gene in patients with pulmonary arterial hypertension].
20011660 2009 ActRIIA and BMPRII Type II BMP receptor subunits selectively required for Smad4-independent BMP7-evoked chemotaxis.
20002458 2010 Identities and frequencies of BMPR2 mutations in Chinese patients with idiopathic pulmonary arterial hypertension.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864167 2010 Novel loci interacting epistatically with bone morphogenetic protein receptor 2 cause familial pulmonary arterial hypertension.
19844076 2010 Sequence variants in BMPR2 and genes involved in the serotonin and nitric oxide pathways in idiopathic pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension: relation to clinical parameters and comparison with left heart disease.
19782107 2009 GDF5 and BMP2 inhibit apoptosis via activation of BMPR2 and subsequent stabilization of XIAP.
19634078 2009 Genetics of pulmonary arterial hypertension.
19628780 2009 Evidence of dysfunction of endothelial progenitors in pulmonary arterial hypertension.
19578724 2009 BMPRII is a direct target of miR-21.
19552837 2009 [Bone morphogenetic protein type II receptor gene promoter mutation-142G > A in a patient with familial pulmonary arterial hypertension].
19531247 2009 Copy-number variation in BMPR2 is not associated with the pathogenesis of pulmonary arterial hypertension.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19424179 2009 Novel crosstalk to BMP signalling: cGMP-dependent kinase I modulates BMP receptor and Smad activity.
19390056 2009 Interleukin-6 modulates the expression of the bone morphogenic protein receptor type II through a novel STAT3-microRNA cluster 17/92 pathway.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366699 2009 Bone morphogenetic protein (BMP) and activin type II receptors balance BMP9 signals mediated by activin receptor-like kinase-1 in human pulmonary artery endothelial cells.
19357154 2009 Alterations in oestrogen metabolism: implications for higher penetrance of familial pulmonary arterial hypertension in females.
19324947 2009 Bone morphogenetic protein signalling in heritable versus idiopathic pulmonary hypertension.
19307479 2009 Stress Doppler echocardiography in relatives of patients with idiopathic and familial pulmonary arterial hypertension: results of a multicenter European analysis of pulmonary artery pressure response to exercise and hypoxia.
19229295 2009 Crystal structure analysis reveals a spring-loaded latch as molecular mechanism for GDF-5-type I receptor specificity.
19223935 2009 Novel promoter and exon mutations of the BMPR2 gene in Chinese patients with pulmonary arterial hypertension.
19206171 2009 Penetrance of pulmonary arterial hypertension is modulated by the expression of normal BMPR2 allele.
19195606 2009 Pro-osteogenic phenotype of human aortic valve interstitial cells is associated with higher levels of Toll-like receptors 2 and 4 and enhanced expression of bone morphogenetic protein 2.
19059957 2008 Molecular mechanisms of pulmonary arterial hypertension: role of mutations in the bone morphogenetic protein type II receptor.
19051722 2008 [Analysis of genetic mutation and modifier genes in pulmonary arterial hypertension].
18792970 2008 BMPR2 mutation in a patient with pulmonary arterial hypertension and suspected hereditary hemorrhagic telangiectasia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18647753 2008 Failure of bone morphogenetic protein receptor trafficking in pulmonary arterial hypertension: potential for rescue.
18621057 2008 A new model for growth factor activation: type II receptors compete with the prodomain for BMP-7.
18503968 2008 Clinical implications of determining BMPR2 mutation status in a large cohort of children and adults with pulmonary arterial hypertension.
18496036 2008 Synergistic heterozygosity for TGFbeta1 SNPs and BMPR2 mutations modulates the age at diagnosis and penetrance of familial pulmonary arterial hypertension.
18436795 2008 Mutations in bone morphogenetic protein type II receptor cause dysregulation of Id gene expression in pulmonary artery smooth muscle cells: implications for familial pulmonary arterial hypertension.
18436533 2008 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
18364108 2008 A novel mutation in the BMPR2 gene in familial pulmonary arterial hypertension.
18356561 2008 Clinical outcomes of pulmonary arterial hypertension in carriers of BMPR2 mutation.
18342887 2008 Characterization of ligand-binding properties of the human BMP type II receptor extracellular domain.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18321866 2008 Stoichiometric imbalance in the receptor complex contributes to dysfunctional BMPR-II mediated signalling in pulmonary arterial hypertension.
18292470 2008 Basal expression of bone morphogenetic protein receptor is reduced in mild asthma.
18221724 2008 [Mutations in the gene encoding bone morphogenetic protein receptor 2 in patients with idiopathic pulmonary arterial hypertension].
18187665 2008 Identification of genetic polymorphisms associated with risk for pulmonary hypertension in sickle cell disease.
18159113 2008 Implications of mutations of activin receptor-like kinase 1 gene (ALK1) in addition to bone morphogenetic protein receptor II gene (BMPR2) in children with pulmonary arterial hypertension.
17992660 2008 Regulation of bone morphogenetic protein signalling in human pulmonary vascular development.
17700526 2008 Stromal inactivation of BMPRII leads to colorectal epithelial overgrowth and polyp formation.
17641158 2007 Characterization of the BMPR2 5'-untranslated region and a novel mutation in pulmonary hypertension.
17624341 2008 Expression of bone morphogenetic proteins 4 and 7 and their receptors IA, IB, and II in human ovaries from fetuses and adults.
17576816 2007 A novel regulatory mechanism of the bone morphogenetic protein (BMP) signaling pathway involving the carboxyl-terminal tail domain of BMP type II receptor.
17515463 2007 Receptor for activated C-kinase 1, a novel interaction partner of type II bone morphogenetic protein receptor, regulates smooth muscle cell proliferation in pulmonary arterial hypertension.
17472960 2007 Repulsive guidance molecule RGMa alters utilization of bone morphogenetic protein (BMP) type II receptors by BMP2 and BMP4.
17363346 2007 A fluorescence study of type I and type II receptors of bone morphogenetic proteins with bis-ANS (4, 4'-dianilino-1, 1'-bisnaphthyl-5, 5' disulfonic acid).
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17322283 2007 Interaction of interleukin-6 and the BMP pathway in pulmonary smooth muscle.
17318011 2007 Genes and pulmonary arterial hypertension.
17277049 2007 Bone morphogenetic protein type 2 receptor gene therapy attenuates hypoxic pulmonary hypertension.
17203235 2007 Hepatocyte growth factor up-regulates the expression of the bone morphogenetic protein (BMP) receptors, BMPR-IB and BMPR-II, in human prostate cancer cells.
17102831 2006 Eisenmenger syndrome and atrial septal defect: nature or nurture?
17094948 2006 High resolution structures of the bone morphogenetic protein type II receptor in two crystal forms: implications for ligand binding.
16982201 2007 Bacterial expression and purification of the ovine type II bone morphogenetic protein receptor ectodomain.
16782755 2006 Tenascin-C is induced by mutated BMP type II receptors in familial forms of pulmonary arterial hypertension.
16717148 2006 Relationship of BMPR2 mutations to vasoreactivity in pulmonary arterial hypertension.
16615932 2006 HIV-1 Tat interaction with cyclin T1 represses mannose receptor and the bone morphogenetic protein receptor-2 transcription.
16436528 2006 Mutual regulation of follicle-stimulating hormone signaling and bone morphogenetic protein system in human granulosa cells.
16429403 2006 BMPR2 gene rearrangements account for a significant proportion of mutations in familial and idiopathic pulmonary arterial hypertension.
16429395 2006 Mutations of the TGF-beta type II receptor BMPR2 in pulmonary arterial hypertension.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339917 2006 Serotonin transporter polymorphisms in familial and idiopathic pulmonary arterial hypertension.
16339782 2006 BMP signaling controls PASMC KV channel expression in vitro and in vivo.
16155937 2006 Interaction and functional cooperation between the serine/threonine kinase bone morphogenetic protein type II receptor with the tyrosine kinase stem cell factor receptor.
16122479 2005 Expression of bone morphogenetic proteins in human lung carcinomas.
16002577 2005 Bone morphogenetic protein receptor type II C-terminus interacts with c-Src: implication for a role in pulmonary arterial hypertension.
15965979 2005 BMPR2 mutations have short lifetime expectancy in primary pulmonary hypertension.
15824058 2005 A dual-light reporter system to determine the efficiency of protein-protein interactions in mammalian cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15775752 2005 Gross BMPR2 gene rearrangements constitute a new cause for primary pulmonary hypertension.
15699281 2005 Investigation of second genetic hits at the BMPR2 locus as a modulator of disease progression in familial pulmonary arterial hypertension.
15687131 2005 Transforming growth factor-beta receptor mutations and pulmonary arterial hypertension in childhood.
15657086 2005 Dynamics and interaction of caveolin-1 isoforms with BMP-receptors.
15621726 2004 Bone morphogenetic proteins.
15591269 2004 Low frequency of BMPR2 mutations in a German cohort of patients with sporadic idiopathic pulmonary arterial hypertension.
15516492 2005 BMP4 inhibits proliferation and promotes myocyte differentiation of lung fibroblasts via Smad1 and JNK pathways.
15492256 2004 Restoration of bone morphogenetic protein receptor type II expression leads to a decreased rate of tumor growth in bladder transitional cell carcinoma cell line TSU-Pr1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358693 2004 BMPR2 mutations in pulmonary arterial hypertension with congenital heart disease.
15354178 2004 Loss of expression of bone morphogenetic protein receptor type II in human prostate cancer cells.
15295086 2004 Primary pulmonary hypertension in children may have a different genetic background than in adults.
15235019 2004 The prevalence of MADH4 and BMPR1A mutations in juvenile polyposis and absence of BMPR2, BMPR1B, and ACVR1 mutations.
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
15146475 2004 BMPR2 mutations found in Japanese patients with familial and sporadic primary pulmonary hypertension.
15055271 2004 Identification of a novel mutation in the gene for bone morphogenetic protein receptor II in an Israeli patient with familial primary pulmonary hypertension.
15031260 2004 Pulmonary hypertension in transgenic mice expressing a dominant-negative BMPRII gene in smooth muscle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676131 2003 Decreased expression of bone morphogenetic protein (BMP) receptor type II correlates with insensitivity to BMP-6 in human renal cell carcinoma cells.
14583445 2003 Functional interaction between BMPR-II and Tctex-1, a light chain of Dynein, is isoform-specific and disrupted by mutations underlying primary pulmonary hypertension.
12963706 2003 Direct signaling by the BMP type II receptor via the cytoskeletal regulator LIMK1.
12819188 2003 The mature bone morphogenetic protein-2 is aberrantly expressed in non-small cell lung carcinomas and stimulates tumor growth of A549 cells.
12543773 2003 Overexpression of a dominant negative type II bone morphogenetic protein receptor inhibits the growth of human breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446270 2003 Pulmonary veno-occlusive disease caused by an inherited mutation in bone morphogenetic protein receptor II.
12415595 2002 Pulmonary hypertension in scleroderma spectrum of disease: lack of bone morphogenetic protein receptor 2 mutations.
12358323 2002 BMPR2 germline mutations in pulmonary hypertension associated with fenfluramine derivatives.
12221115 2002 Functional heterogeneity of bone morphogenetic protein receptor-II mutants found in patients with primary pulmonary hypertension.
12135884 2002 Bone morphogenetic protein receptor type II is a receptor for growth differentiation factor-9.
12045205 2002 Functional analysis of bone morphogenetic protein type II receptor mutations underlying primary pulmonary hypertension.
11686884 2001 Bone morphogenetic proteins, genetics and the pathophysiology of primary pulmonary hypertension.
11502704 2001 Altered growth responses of pulmonary artery smooth muscle cells from patients with primary pulmonary hypertension to transforming growth factor-beta(1) and bone morphogenetic proteins.
11484688 2001 Mutation in the gene for bone morphogenetic protein receptor II as a cause of primary pulmonary hypertension in a large kindred.
11401330 2001 Effect of bone morphogenetic protein-6 on haemopoietic stem cells and cytokine production in normal human bone marrow stroma.
11115378 2001 BMPR2 haploinsufficiency as the inherited molecular mechanism for primary pulmonary hypertension.
11015450 2000 Sporadic primary pulmonary hypertension is associated with germline mutations of the gene encoding BMPR-II, a receptor member of the TGF-beta family.
10973254 2000 Heterozygous germline mutations in BMPR2, encoding a TGF-beta receptor, cause familial primary pulmonary hypertension.
10964520 2000 A physical and transcript map based upon refinement of the critical interval for PPH1, a gene for familial primary pulmonary hypertension. The International PPH Consortium.
10903931 2000 Familial primary pulmonary hypertension (gene PPH1) is caused by mutations in the bone morphogenetic protein receptor-II gene.
10880444 2000 BMP-2 antagonists emerge from alterations in the low-affinity binding epitope for receptor BMPR-II.
10712517 2000 Bone morphogenetic protein receptor complexes on the surface of live cells: a new oligomerization mode for serine/threonine kinase receptors.
10051328 1999 Chromosomal localization of three human genes encoding bone morphogenetic protein receptors.
9525338 1998 Cartilage-derived morphogenetic proteins and osteogenic protein-1 differentially regulate osteogenesis.
9442116 1998 Bone morphogenetic protein signaling is required for maintenance of differentiated phenotype, control of proliferation, and hypertrophy in chondrocytes.
9193425 1997 Mapping of familial primary pulmonary hypertension locus (PPH1) to chromosome 2q31-q32.
9054941 1997 Localization of the gene for familial primary pulmonary hypertension to chromosome 2q31-32.
8707881 1996 Analysis of the native murine bone morphogenetic protein serine threonine kinase type I receptor (ALK-3).
8702914 1996 Identification of type I and type II serine/threonine kinase receptors for growth/differentiation factor-5.
8592941 1995 Enhanced expression of type I receptors for bone morphogenetic proteins during bone formation.
7890683 1995 Cloning of a novel type II serine/threonine kinase receptor through interaction with the type I transforming growth factor-beta receptor.
7791754 1995 Human type II receptor for bone morphogenic proteins (BMPs): extension of the two-kinase receptor model to the BMPs.
7673243 1995 Identification of a human type II receptor for bone morphogenetic protein-4 that forms differential heteromeric complexes with bone morphogenetic protein type I receptors.
7644468 1995 Cloning and characterization of a human type II receptor for bone morphogenetic proteins.