Property Summary

NCBI Gene PubMed Count 84
PubMed Score 74.22
PubTator Score 61.39

Knowledge Summary

Patent (9,109)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 1.7e-08
medulloblastoma -3.400 4.9e-05
cystic fibrosis 1.698 7.1e-05
atypical teratoid / rhabdoid tumor 1.500 2.3e-03
glioblastoma 1.100 2.7e-04
medulloblastoma, large-cell -3.000 1.9e-04
intraductal papillary-mucinous adenoma (... -1.900 6.7e-03
Hydrolethalus syndrome -1.398 4.6e-02
breast carcinoma 3.000 1.6e-04
invasive ductal carcinoma 1.513 1.4e-02
nasopharyngeal carcinoma -1.300 1.9e-03
Endometriosis -1.408 7.2e-03
lung carcinoma 2.100 1.2e-07
Alzheimer's disease 1.200 2.9e-02
Pick disease 2.900 9.8e-07
Breast cancer 1.100 2.5e-02
ovarian cancer 1.600 3.1e-02
pituitary cancer -1.900 5.7e-04
head and neck cancer -1.200 3.4e-03
head and neck cancer and chronic obstruc... -1.300 2.1e-04

Protein-protein Interaction (9)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (42)

PMID Text
26684357 Low expression of BMPRIB is associated with breast cancer.
26562759 Using computational analyses with the COREX/BEST algorithm, the study uncovered an overall pattern connecting various regions of BMPR-1B ectodomain, including the four conserved residues in the protein-protein interface.
26105076 Data found a hypomorphic BMPR1B mutation causes du Pan acromesomelic dysplasia
25776145 Novel mutation in the BMPR1B gene (R486L) in a Polish family and further delineation of the phenotypic features of BMPR1B-related brachydactyly.
25758993 Two novel mutations in BMPR1B were identified in two patients with brachydactyly type A1.
25601208 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response.
24339876 Disrupting the binding of miR-125b toward BMPR1B would increase protein expression, diminishing abnormal cell proliferation as well as serum and cellular CA125 levels
24129431 Data indicate missense (c.157T>C, p.(C53R)) or nonsense (c.657G>A, p.(W219*)) mutations in bone morphogenetic protein receptor type IB (BMPR1B) in two consanguineous families with acromesomelic chondrodysplasia-type Grebe.
24100446 Using primary cells and a cell line mimicking CP-CML, we found that myeloid progenitor expansion is driven by the exposure of immature cells overexpressing BMP receptor Ib to BMP2 and BMP4.
24021264 the shear-induced apoptosis and autophagy are mediated by bone morphogenetic protein receptor type (BMPR)-IB, BMPR-specific Smad1 and Smad5, and p38 mitogen-activated protein kinase.
24008158 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Nef downregulates expression of BMPR-2, BMPR-1A, and BMPR-1B proteins
22971142 A significant association was observed between the 455C allele of BMP4 and increased left ventricular internal diameter systolic (p=0.004) and between 1650T allele of BMPR1B and lower left atrium diameter (p=0.038).
22374147 Suggest that BMPR1B mutations are associated with the pathogenesis of childhood idiopathic pulmonary arterial hypertension.
22294741 BMP15 uses preferentially BMPR1B as its type I receptor, suggesting an important role for the BMPR1B receptor in human female fertility
22293501 generation of TGF-beta and BMP receptor homo- and hetero-oligomers and its roles as a mechanism capable of fast regulation of signaling by these crucial cytokines [review]
21556765 rs1434536 in the 3'UTR of BMPR1B gene affects the binding ability of miR-125b to BMPR1B mRNA and contributes to the genetic predisposition to localized prostate cancer and patients aged>70 years.
21152263 BMPR1B were detected in the human retina and retinoblastoma cell lines.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20673479 Data show that blocking both endogenous BMPR1A and BMPR1B almost offset the effect of BMP7 on the proliferation of NCI-H460 cell completely.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20587070 Low BMP2 is associated with epithelial ovarian cancer.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19738052 Results suggest that allele-specific regulation of BMPR1B by miR-125b explains the observed disease risk in breast cancer.
19513897 Decrease BMPR-1B expression led to decreased SMAD1 phosphorylation and correlated witht he malignant grade of human gliomas and a poor prognosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19451094 decreased expression of BMPR-IB correlates with poor prognosis in breast cancer patients and leads to increased cell proliferation of breast cancer cells in vitro
19135982 the interaction of Ror2 with BRIb is specific and independent of post-translational N-glycosylation.
18773965 Our study has provided evidence that BMPR-IB-dependent signaling plays a crucial role in BMP-2 up-regulation of the ALP, OC, Dlx5 and Cbfa1 genes in bone cells, suggesting a role of this receptor in BMP-2-induced osteoblast differentiation in vitro.
18619554 Changes in BMPR1B localization regulate osteogenic responses of bone cells to BMP2.
18292470 there was significant down-regulation of ALK-6 (activin receptor-like kinase 6) expression in asthma patients at baseline; allergy challenge was associated with upregulation
17624341 Expression of BMP-4 and BMP-7 and their receptors in human ovaries from fetuses as well as adults.
17381068 Our results indicated the potential involvement of ALK6 activation by rhTGFbetas in the synergy between rhTGFbetas and rhBMPs.
17363346 significant shift in the emission maximum from 498 to 510 nm was detected when bis-ANS binds ecBMPR-IB. FRET revealed close proximity between the tyrosine & bis-ANS binding site.
17203235 HGF up-regulates the expression of the bone morphogenetic protein receptors, BMPR-IB and BMPR-II, in prostate cancer cells
17001689 Results indicate that increased bone morphogenetic protein receptor (BMPR)-IB by TGF-beta1, FGF-2, and PDGF-AB significantly enhances BMP-2-induced osteogenesis in vitro.
16436528 Human granulosa-like tumor cell line KGN expressed BMP type I (BMPR1A and BMPR1B) and type II receptors (BMPR2) and the BMP signaling molecules SMADs (SMAD1 and SMAD5).
16014698 GDF5 is a novel brachydactyly type A2 causing gene involving BMPR1b impaired activity.
15897891 Anti mullerian hormnoe is a gonadal tumor suppressor which mediates its effects through a specific type II receptor and the bone morphogenetic protein (BMP)-specific Smad proteins.
15235019 Observational study of genotype prevalence. (HuGE Navigator)
15192043 the BMP system is strongly involved in pulmonary artery smooth muscle mitosis through ALK-6, resulting in the progression of vascular remodeling of pulmonary arteries in pulmonary hypertension.
14576167 BMP-2-induced apoptosis was mediated by BMP-RIB in osteoblasts and occurred independently of BMP-2-induced osteoblast differentiation.
14523231 performed linkage analysis in brachydactyly (BD) type A2 and mapped a locus for BD type A2 to 4q21-q25. This interval includes the gene bone morphogenetic protein receptor 1B.

AA Sequence

MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSG      1 - 70
CLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLV     71 - 140
LIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQI    141 - 210
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITD    211 - 280
YHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIAD    281 - 350
LGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV    351 - 420
EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKT    421 - 490
LAKMSESQDIKL                                                              491 - 502
//

Text Mined References (87)

PMID Year Title
26684357 2016 Low expression of BMPRIB indicates poor prognosis of breast cancer and is insensitive to taxane-anthracycline chemotherapy.
26562759 2015 Long-Range Communication Network in the Type 1B Bone Morphogenetic Protein Receptor.
26105076 2015 A hypomorphic BMPR1B mutation causes du Pan acromesomelic dysplasia.
25776145 2015 Novel mutation in the BMPR1B gene (R486L) in a Polish family and further delineation of the phenotypic features of BMPR1B-related brachydactyly.
25758993 2015 Two novel disease-causing variants in BMPR1B are associated with brachydactyly type A1.
25601208 2015 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response.
24904118 2014 HFE interacts with the BMP type I receptor ALK3 to regulate hepcidin expression.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24339876 2013 BMPR1B up-regulation via a miRNA binding site variation defines endometriosis susceptibility and CA125 levels.
24129431 2014 Homozygous missense and nonsense mutations in BMPR1B cause acromesomelic chondrodysplasia-type Grebe.
24100446 2013 Primitive CML cell expansion relies on abnormal levels of BMPs provided by the niche and on BMPRIb overexpression.
24098149 2013 A GDF5 point mutation strikes twice--causing BDA1 and SYNS2.
24021264 2013 Mechanical regulation of cancer cell apoptosis and autophagy: roles of bone morphogenetic protein receptor, Smad1/5, and p38 MAPK.
22971142 2012 Common genetic variants of the BMP4, BMPR1A, BMPR1B, and ACVR1 genes, left ventricular mass, and other parameters of the heart in newborns.
22384028 2012 A genome-wide linkage and association scan reveals novel loci for hypertension and blood pressure traits.
22374147 2012 Missense mutations of the BMPR1B (ALK6) gene in childhood idiopathic pulmonary arterial hypertension.
22294741 2012 A covalently dimerized recombinant human bone morphogenetic protein-15 variant identifies bone morphogenetic protein receptor type 1B as a key cell surface receptor on ovarian granulosa cells.
22293501 2012 Oligomeric interactions of TGF-? and BMP receptors.
21976273 2012 New insights into the molecular mechanism of multiple synostoses syndrome (SYNS): mutation within the GDF5 knuckle epitope causes noggin-resistance.
21556765 2012 A miR-125b binding site polymorphism in bone morphogenetic protein membrane receptor type IB gene and prostate cancer risk in China.
21152263 2010 Bone morphogenetic protein 4 (BMP4) signaling in retinoblastoma cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20673479 2010 [BMP7 signaling via BMPR1A, BMPR1B inhibits the proliferation of lung large carcinoma NCI-H460 cell].
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20587070 2010 Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19738052 2009 A risk variant in an miR-125b binding site in BMPR1B is associated with breast cancer pathogenesis.
19513897 2009 Expression and functional roles of Smad1 and BMPR-IB in glioma development.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19451094 Reduced expression of BMPR-IB correlates with poor prognosis and increased proliferation of breast cancer cells.
19229295 2009 Crystal structure analysis reveals a spring-loaded latch as molecular mechanism for GDF-5-type I receptor specificity.
19135982 2009 Biochemical and functional characterization of the Ror2/BRIb receptor complex.
18773965 2008 RNA interference of the BMPR-IB gene blocks BMP-2-induced osteogenic gene expression in human bone cells.
18619554 2008 Changes in bone morphogenetic protein receptor-IB localisation regulate osteogenic responses of human bone cells to bone morphogenetic protein-2.
18436533 2008 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18292470 2008 Basal expression of bone morphogenetic protein receptor is reduced in mild asthma.
18184661 2008 Bone morphogenetic proteins signal through the transforming growth factor-beta type III receptor.
17624341 2008 Expression of bone morphogenetic proteins 4 and 7 and their receptors IA, IB, and II in human ovaries from fetuses and adults.
17381068 2006 Potential involvement of BMP receptor type IB activation in a synergistic effect of chondrogenic promotion between rhTGFbeta3 and rhGDF5 or rhBMP7 in human mesenchymal stem cells.
17363346 2007 A fluorescence study of type I and type II receptors of bone morphogenetic proteins with bis-ANS (4, 4'-dianilino-1, 1'-bisnaphthyl-5, 5' disulfonic acid).
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17203235 2007 Hepatocyte growth factor up-regulates the expression of the bone morphogenetic protein (BMP) receptors, BMPR-IB and BMPR-II, in human prostate cancer cells.
17001689 2006 Up-regulation of bone morphogenetic protein receptor IB by growth factors enhances BMP-2-induced human bone cell functions.
16957682 2006 A novel R486Q mutation in BMPR1B resulting in either a brachydactyly type C/symphalangism-like phenotype or brachydactyly type A2.
16436528 2006 Mutual regulation of follicle-stimulating hormone signaling and bone morphogenetic protein system in human granulosa cells.
16127465 2005 Activating and deactivating mutations in the receptor interaction site of GDF5 cause symphalangism or brachydactyly type A2.
16014698 2006 A mutation in the receptor binding site of GDF5 causes Mohr-Wriedt brachydactyly type A2.
15897891 2005 Role of type I receptors for anti-Müllerian hormone in the SMAT-1 Sertoli cell line.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15805157 2005 A homozygous BMPR1B mutation causes a new subtype of acromesomelic chondrodysplasia with genital anomalies.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15235019 2004 The prevalence of MADH4 and BMPR1A mutations in juvenile polyposis and absence of BMPR2, BMPR1B, and ACVR1 mutations.
15192043 2004 Characterization of the bone morphogenetic protein (BMP) system in human pulmonary arterial smooth muscle cells isolated from a sporadic case of primary pulmonary hypertension: roles of BMP type IB receptor (activin receptor-like kinase-6) in the mitotic action.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576167 2004 Bone morphogenetic protein receptor IB signaling mediates apoptosis independently of differentiation in osteoblastic cells.
14523231 2003 Mutations in bone morphogenetic protein receptor 1B cause brachydactyly type A2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419820 2003 Molecular basis of bone morphogenetic protein-15 signaling in granulosa cells.
12135884 2002 Bone morphogenetic protein receptor type II is a receptor for growth differentiation factor-9.
12065756 2002 SB-431542 is a potent and specific inhibitor of transforming growth factor-beta superfamily type I activin receptor-like kinase (ALK) receptors ALK4, ALK5, and ALK7.
11781009 2001 Involvement of BMP-2 signaling in a cartilage cap in osteochondroma.
11483516 2001 Promoting bone morphogenetic protein signaling through negative regulation of inhibitory Smads.
11420127 2001 Anti-Müllerian hormone and its receptors.
11401330 2001 Effect of bone morphogenetic protein-6 on haemopoietic stem cells and cytokine production in normal human bone marrow stroma.
11312159 2001 The Booroola (FecB) phenotype is associated with a mutation in the bone morphogenetic receptor type 1 B (BMPR1B) gene.
11282024 2001 Synergistic effects of different bone morphogenetic protein type I receptors on alkaline phosphatase induction.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11266516 2001 Modulation of activin signal transduction by inhibin B and inhibin-binding protein (INhBP).
10850425 2000 Expression of bone morphogenetic protein receptors type-IA, -IB and -II correlates with tumor grade in human prostate cancer tissues.
10712517 2000 Bone morphogenetic protein receptor complexes on the surface of live cells: a new oligomerization mode for serine/threonine kinase receptors.
10504300 1999 Characterization of bone morphogenetic protein-6 signaling pathways in osteoblast differentiation.
10051328 1999 Chromosomal localization of three human genes encoding bone morphogenetic protein receptors.
9950587 1999 Bone morphogenetic proteins and growth and differentiation factors in the human cornea.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9730621 1998 Assignment of the BMPR1A and BMPR1B genes to human chromosome 10q22.3 and 4q23-->q24 byin situ hybridization and radiation hybrid map ping.
9525338 1998 Cartilage-derived morphogenetic proteins and osteogenic protein-1 differentially regulate osteogenesis.
9178898 1997 Cloning of human bone morphogenetic protein type IB receptor (BMPR-IB) and its expression in prostate cancer in comparison with other BMPRs.
8707881 1996 Analysis of the native murine bone morphogenetic protein serine threonine kinase type I receptor (ALK-3).
8702914 1996 Identification of type I and type II serine/threonine kinase receptors for growth/differentiation factor-5.
8605097 1996 Bone morphogenetic protein type IB receptor is progressively expressed in malignant glioma tumours.
8140412 1994 Characterization of type I receptors for transforming growth factor-beta and activin.
7811286 1994 A mammalian serine/threonine kinase receptor specifically binds BMP-2 and BMP-4.