Property Summary

NCBI Gene PubMed Count 223
PubMed Score 1431.02
PubTator Score 822.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 6.2e-10
oligodendroglioma 1.700 2.0e-03
esophageal adenocarcinoma -1.400 2.0e-02
psoriasis -2.200 2.9e-04
cutaneous lupus erythematosus -1.500 2.0e-03
glioblastoma 1.500 1.4e-03
osteosarcoma 2.158 1.6e-02
sonic hedgehog group medulloblastoma -1.700 1.9e-02
atypical teratoid / rhabdoid tumor 2.400 5.0e-03
non-small cell lung cancer 2.227 1.6e-09
lung cancer 3.800 3.3e-06
interstitial cystitis -1.200 2.4e-03
pilocytic astrocytoma 1.700 2.8e-07
ovarian cancer -1.200 6.3e-05

Protein-protein Interaction (9)

Gene RIF (185)

PMID Text
26824865 Adenovirus-mediated FoxC2 expression enhances BMP7-facilitated anabolism in nucleus pulposus cells of the intervertebral discs.
26695677 Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression.
26617798 miR-137/BMP7 axis could contribute to the progression of non-small cell lung cancer.
26503415 Inhibition of BMP7 expression mediated by KDM5C promotes neoplasm invasion in hepatocellular carcinoma cells.
26466853 Heterodimeric BMP-2/7 significantly promoted osteogenesis of human adipose-derived stem cells in vitro and in vivo. However, BMP-2/7 was not found to be a stronger inducer of osteogenesis compared to homodimeric either BMP-2 or BMP-7.
26417691 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7.
26385023 the role of BMP-7 and its downstream signals in the neuroprotective effects of oxygen-glucose deprivation preconditioning
26304754 BMP4, BMP7 and receptors are expressed and active in the human fetal leptomeninges.
26112332 MiR-22 promotes the development of liver cirrhosis through BMP7 suppression.
25716319 hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype
25662552 rs6127973 may be a risk factor of being Nonsyndromic orofacial clefts and confirmed the role of BMP7 gene in orofacial deformity from Western Han Chinese
25534037 Exposure of adipogenic stem cells to BMP7 promoted gene expression signatures of brown adipocytes.
25192984 BMP-7 improves proliferation and hematopoietic reconstitution potential of ex vivo expanded cord blood-derived CD34(+). cells.(
25152406 HMSC from osteoporotic patients showed a significant increase of migration upon BMP-2 or FCS stimulation, as well as a significant increase of invasion upon BMP-2, BMP-7 or FCS stimulati
25091889 OP-1 levels detected by a polyclonal antibody were found to be much higher than the reference range and correlated positively with the severity of osteoarthritis
24970050 Study highlights the potential importance of RGMb in propagating pro-angiogenic effects of HGF and BMP-7.
24969562 BMP-7 inhibits TGF-beta-induced cholangiocarcinoma cell migration through inhibition of TGF-beta-mediated Twist and N-cadherin expression
24820464 BMP-7 may play anti-inflammatory and anti-fibrogenic roles in the pathogenesis of chronic hepatitis B infection.
24477555 Both BMP2 and BMP7 promote odontogenic and osteogenic differentiation of human tooth germ stem cells.
24418819 BMP-7 represses albumin-induced chemokine synthesis in kidney tubular epithelial cells through destabilization of NF-kappaB-inducing kinase.
24384427 BMP5 and BMP7, involved in cardiomyocyte differentiation defect
24284793 BMP4/BMP7 have similar effects on white-to-brown transition in primary human adipose stem cells.
24205156 50 ng/ml BMP-2/7 could antagonize ATRA and significantly enhance the mineralization.
24190429 BMP7 induces Langerhans cell differentiation and proliferation by activating the BMP type-I receptor ALK3 in the absence of canonical TGF-beta1-ALK5 signaling.
24184479 These findings indicate that BMP-7 mediates ischemic preconditioning -induced tolerance to cerebral ischemia/reperfusion, probably through inhibition of apoptosis.
24117149 Expression and purification of recombinant human bone morphogenetic protein-7 in Escherichia coli.
24072698 We demonstrate a cross-talk between BMPs and CRYAB and a major effect of this regulatory interaction on resistance to apoptosis.
24069261 BMP7 expression correlates with secondary drug resistance in mantle cell lymphoma.
24023033 Bone morphogenetic protein 7 increased vascular endothelial growth factor-a expression in human granulosa cells and VEGF receptor expression in endothelial cells to stimulate angiogenesis.
24008158 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Tat induces significantly higher secretion of BMP-2 and BMP-7 ligands when compared with that of untreated cells
23888776 A novel human bone morphogenetic protein-7 variant with an enriched heparin-binding site
23853066 determined whether BMP-2, -6, and -7 differentially regulate the proliferation, mineralization, and mRNA expression of bone/mineralized tissue associated genes of human periodontal ligament stem cells obtained from periodontal ligament tissue
23825642 stimulation potential with BMP-2 and BMP-7 of tenocyte-like cells
23747893 summarize recent knowledge of BMP-7 function and discuss attempts to use this cytokine as a drug to reverse TGF-beta-induced fibrogenesis
23697978 These results suggested an association between a BMP7 single nucleotide polymorphism and selective serotonin reuptake inhibitors treatment response.
23651239 Data show expression of TGF-beta1, TGF-beta2, BMP-4, and BMP-7 was increased in tumor-associated macrophages (TAMs) cocultured with pancreatic cancer cells, and vasohibin-1, VEGF-A, and vVEGF-C expression in pancreatic cancer cells was upregulated by TAMs.
23580474 Nucleus pulposus cells expressing hBMP7 can prevent the degeneration of allogenic intervertebral disc degeneration in a canine transplantation model.
23539268 Exogenous BMP-7 significantly decreased the degree of hepatic fibrosis in both the acute and chronic stages of hepato-schistosomiasis, and the regulatory mechanism may involve the TGF-beta/Smad signaling pathway.
23504348 BMP7 modulates the expression of E-cadherin and MMP-9, and by which mechanism it may regulate cell migration and metastasis of esophageal squamous cell carcinoma.
23471555 The anti-fibrogenic mechanism of rhBMP-7 in the rat liver fibrosis was depended on the reduction of TGF-b1 overexpression and the inhibition of TGF-b1 triggered intracellular signalling in hepatic cells.
23455153 monoubiquitinated SMAD6 impairs the binding affinity of non-modified SMAD6 to the BMP type I receptor. Moreover, UBE2O and SMAD6 cooperated in the regulation of BMP7-induced adipogenesis
23386650 Theca cell-derived BMP4 and BMP7 down-regulate Cx43 expression and decrease gap junction cell communication activity in human granulosa cells.
23243027 These studies support a model in which DeltaNp63alpha-mediated activation of BMP signaling governs epithelial cell plasticity, EMT, and tumorigenicity during breast cancer initiation and progression.
23179403 High BMP7 expression is associated with hepatocellular carcinoma.
23132958 Data conclude that BMP7/OP-1 inhibits the generation of osteoclasts by interfering with signalling pathways.
23126427 Review of roles TGF-beta and BMP-7 play in CKDs (chronic kidney diseases). Targeting the TGF-beta/Smad pathway or restoring BMP-7 signalling may represent novel therapies for CKDs.
23046931 RhBMP-7 can induce murine BMSCs to differentiate into osteoblast in vitro.
22958403 Recombinant TGFbeta1 effectively blocks recombinant BMP-2 and BMP-7 signaling in osteoblasts.
22795855 analysis of osteogenesis induced by a bone forming peptide from the prodomain region of BMP-7
22778550 Results demonstrated that it was advantageous to construct tissue engineering bone using ADSCs cotransfected with BMP2 and BMP7 on beta-TCP.The results showed the BMP2 and BMP7 genes cotransfection group dramatically enhanced new bone formation.
22720873 BMP7 has a unique potential to polarize monocytes into M2 macrophages.
22674456 BMP2 and BMP7 have roles in inflammation, but BMP7 has a greater role in soft tissue edema
22525892 A decrease in BMP-7 expression results from knockdown of markers of epithelial-to-mesenchymal transition by gremlin protein.
22490392 There is efficient and reproducible induction of SZP/lubricin accumulation by TGF-beta1 and BMP-7 in skeletal muscle-derived mesenchymal stem cells.
22447022 BMP7 has an important role in controlling lung cancer cell motility and invasiveness.
22305102 Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells.
22253716 Cloacal partitioning is driven by Bmp7 signaling in the cloacal endoderm.
22244873 These findings indicate that F-spondin regulates the differentiation of human cementoblast-like cells via BMP7 expression.
22212474 Bone morphogenic protein-7 (BMP-7) regulates the cell proliferation and is important for renal development and physiology
22209843 these data show that BMP-4 and BMP-7 are associated with granulosa cell survival via several non-Smad specific pathways: BMP-4 via the PI3K/PDK-1/PKC and BMP-7 via the PI3K/PDK-1/Akt.
22209770 this gene delivery system provides a reliable source of functional BMP7 protein for future in vitro and in vivo studies
22140272 Single-nucleotide polymorphisms in the KITLG gene showed significant associations with testicular cancer
22124112 the BMP7-BMPR2-p38-NDRG1 axis plays a critical role in dormancy and recurrence of prostate CSCs in bone
22118688 components of the common cellular transcriptional response to BMP4 and BMP7
22099397 Findings point towards a regulatory role of BMP-7 that relies on modulation of Mitogen-activated protein kinases rather than mechanisms that are exclusively driven by differential Smad activation.
22048752 There are no differences of Stro-1(+) cells, BMPRs(+) cells, and BMP7 concentration between male and female patients with total hip replacement.
21935711 BMP-7 may exert anti-invasive actions by inhibiting TGF-beta-induced expression of integrin beta(3).
21924665 the involvement of BMP7 in several pathological conditions, such as incomplete fracture healing, osteoarthritis, the development of bone metastases, renal fibrosis and obesity.
21913019 High BMP7 expression is associated with esophageal squamous cell carcinoma.
21898381 BMP-6 mainly inhibited plasmablast differentiation, and BMP-7 mainly induced apoptosis in human memory B cells
21896235 No differences in gene expression levels of other members of the BMP family were observed in the LC, and BMP7 gene expression was normal in the prefrontal cortex and amygdala in MDD subjects.
21842277 Mechanical loading upregulates BMP7, likely via the VDR, but not BMP2, gene and protein expression in osteocytes in vitro.
21765909 BMP-7-induced dendritic growth was blocked when transcription was inhibited within the first 24 hr after adding exogenous BMP-7.
21644225 the rs6025422 polymorphism in (BMP7) gene may be associated with diabetes mellitus and insulin resistance in Uygur men
21609526 The rs6025422 polymorphism in the BMP7 gene is linked with hypertriglyceridemia phenotype in Uygur Chinese population.
21591998 these data suggest activation of TGF-beta signaling and suppression of BMP7 expression in the manifestation of oral submucous fibrosis.
21506685 transfected BMP-7 enhances both in vitro and in vivo osteogenesis
21485009 these results indicate that Bmp7 is indirectly required for corpus callosum formation by controlling the timely differentiation of its guidepost cells
21458096 Findings suggested that BMP7 may stimulate insulin secretion and improve islet cell function in humans.
21447156 Gene array data strongly suggest a critical role of OP-1 in human cartilage homeostasis
21317922 findings indicate high MYC levels drive BMP7 overexpression, promoting cell survival in medulloblastoma cells suggesting the potential relevance of targeting the BMP/SMAD pathway as a novel therapeutic approach for the treatment of childhood MB
21305726 BMP- 7 plays an important protective role in renal inflammatory diseases preventing greater damage and fibrosis
21224856 BMP-7 expression is one of the strong predictors of risk of tumour recurrence in gastric cancer.
21110425 BMP-7 may play an important role as anti-inflammatory and anti-fibrogenic effect in the fibrogenesis of chronic hepatitis B.
21080950 Reduced expression of BMP7 is determined in patients with hypertensive nephrosclerosis.
20952383 when both proteins are expressed in the same cell, sclerostin can antagonize BMP signaling directly by inhibiting BMP7 secretion
20932341 There was no dose limiting toxicity of BMP-7 identified in this safety and tolerability study overall and no differences in adverse event rates between BMP-7 and placebo groups.
20887146 Recombinant human OP-1 (bone morphogenetic protein 7) induces an immune response following its use as a bone graft alternative. This response was transient and diminished over time.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20682677 Results indicate that bone morphogenetic proteins 2, 4, and7 may play a role in the process of spinal ankylosis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20670444 Surgical procedures of cartilage regeneration lead to an up-regulation of both BMP-2 and BMP-7 that in future might be used as a prognostic factor or to support cartilage healing.
20656331 In vitro treatment of whole blood with BMP7 markedly increased the population of tissue factor-positive monocytes from 1.5+/-0.6 % to 31.0+/-7.6 % (p<0.001).
20632031 BMPs, especially BMP-7, warrant further investigation as possible markers for the aggravation of airway remodelling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20573231 BMP-7 modulates the profibrotic effects of TGF-beta1 on normal lung fibroblasts.
20546278 Observational study of gene-disease association. (HuGE Navigator)
20540029 BMP-7 mRNA and protein expression were down-regulated in clear cell renal carcinoma.
20530416 BMP7 protein is a pivotal regulator of cell motility in lung cancer with little impact on the growth of tumour cells. BMP7 expression is linked to lymph node involvement in patients with lung cancer.
20506283 Data establish BMP7 as an important gene in eye development, and suggest that BMP7 should be considered during clinical evaluation of individuals with developmental eye anomalies.
20445470 OP-1 combined with locally obtained autograft is a safe and effective alternative for iliac crest autograft in instrumented single-level posterolateral fusions of the lumbar spine.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20188872 The results showed that bone marrow mesenchymal stromal cells expressing BMP7 preferred a pore size between 100 and 300 microm in silk fibroin protein fabricated scaffolds.
20126477 our results show that BMP-7 is expressed at the highest level in advanced castration-resistant prostate cancer cells
20085912 Progesterone-induced suppression of BMP7 and BMP7-induced inhibition of decidualization and proliferation of ESC suggest an elaborate regulatory mechanism for decidualization through BMP7 in the endometrium
19950204 the role of bone morphogenetic protein-7 (BMP-7) in chondrogenic and osteogenic differentiation of human bone marrow multipotent mesenchymal stromal cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846067 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19816049 These data suggest that BMP-7 can block CsA-induced EMT by downregulating the expression of CTGF, a downstream mediator of EMT.
19725097 BMP7 gene-modified bone marrow stromal cells and load-bearing can promote bone regeneration in segmental defects.
19597895 Data suggest inhibition of BMP-7, by Drm (Gremlin), follistatin, and Noggin and upregulation of BMP-4 may play an integral role in the development of nonunions.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19453255 Polymorphisms in BMP7 are associated with inverse relationships between bone mineralization and vascular calcification in the coronary, carotid, and abdominal aorta in a diabetes-enriched cohort of European Americans.
19403392 Administration of BMP-7 can significantly suppress the down-regulation of nephrin expression and maintain its normal distribution in the podocytes in diabetic rats possibly in association with a direct suppression of TGF-betasignaling.
19396502 BMP-7 as a bone-stimulating agent combined with conventional autograft resulted in a nonunion healing rate of 100%.
19301001 BMP-7 might serve as a biochemical parameter for determining disease severity in primary knee osteoarthritis (OA) and could play a potential role in cartilage protection and repair of OA.
19283074 Further validation of candidate genes on a separate cohort of low and high grade prostate cancers by quantitative MethyLight analysis has allowed us to confirm DNA hypermethylation of HOXD3 and BMP7...
19240369 Osteoblasts exposed in dose-dependent manner to rhBMP-2, -4 and -7 had significantly lower rates of proliferation and higher rate of apoptosis.
19180920 VEGF165 may partially inhibit TGF-beta1-induced epithelial-mesenchymal transition by upregulating the expressions of BMP-7 and Id2.
19116903 IL1B can affect all the key steps in OP-1 signaling in chondrocytes
19112509 BMP-7 has no anti-fibrotic effect in lung or skin fibrosis either in vivo or in vitro
19108831 BMP-7 increases follicle-stimulating hormone (FSH) receptor mRNA levels in human ovarian follicles, whereas it decreases luteinizing hormone receptor gene expression.
19056781 BMP-7 does not inhibit mesenchymal-to-epithelial transition in either primary or immortalized human proximal tubule cells.
18980801 BMP7 can promote and inhibit cell growth in breast cancer cell lines and, in a suitable environment, can also considerably induce breast cancer cell migration and invasion
18978678 Observational study of gene-disease association. (HuGE Navigator)
18621057 Results showed that type II receptors, such as BMP receptor II, activin receptor IIA, and activin receptor IIB, competed with the pd for binding to the growth factor and displaced the prodomain from the complex.
18560367 acts as an autocrine growth inhibitor in melanocytic cells; advanced melanoma cells may escape from BMP7-induced inhibition through concomitant aberrant expression of Noggin
18514338 A significant elevation in expression of BMP7 in oral squamous cell carcinoma cells was seen in carbon and neon-irradiated cells.
18508541 Promise for therapeutic utility of rhBMP7 or small molecule BMP7 agonists in patients with chronic kidney diseases,[REVIEW]
18496506 BMP-7 ameliorates IgA nephropathy-derived polymeric IgA-induced TNF-alpha and TGF-beta synthesis in human mesangial cells through multiple mechanisms involving inhibitory Smads and PPAR-gamma.
18465455 Overproduction of BMP-7 was noted in ankylosing spondylitits(AS) patients and serum BMP-7 levels reflected radiologic damage observed in AS
18436533 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells
18393351 This study was initiated to examine the effects of BMP-7 (also called Osteogenic Protein-1) on the temporal and spatial expression patterns of other BMPs and the BMP receptors in cell cultures of adult rat Achilles and Patellar tendons.
18349123 Expression of BMP1, BMP6, BMP7, and BMP-receptor 2 was significantly increased in advanced stages of myelofibrosis compared and enhanced levels of BMP6 expression were already evident in prefibrotic stages of primary myelofibrosis.
18328806 DeltaNp63/BMP-7 signaling pathway modulates wound healing process through the regulation of matrilin-2.
18292470 Allergen challenge was associated with marked and sustained up-regulation of BMP-7 in airway epithelium and infiltrating inflammatory cells
18259822 Significantly higher BMP7 expression is associated with colorectal cancer
18160010 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Tat induces significantly higher secretion of BMP-2 and BMP-7 ligands when compared with that of untreated cells
18032587 This screen identified a bone morphogenetic protein (BMP) antagonist, SOSTDC1 (sclerostin domain-containing-1) as down-regulated in kidney tumors.
18029192 BMP-7 but not BMP-2 and BMP-4 prevents the loss of primitive hematopoietic progenitor cells cultured in SFM plus SF3.
17909016 In breast cancer, bone morphogenetic protein 7 (BMP7) is a novel target gene regulated by the p53 family and mediates the cell survival function of the basal physiologically relevant level of p53.
17724140 Results suggest that bone morphogenic protein 7 controls and preserves the epithelial phenotype in the human prostate and underscore a decisive role of the tumor microenvironment in mediating the therapeutic response of BMP7.
17656261 Approximately half of the prostate tumors displayed increased copy numbers of the BMP2, BMP5, BMP7, and UC28 gene loci, which may account for their abnormal gene expression patterns in neoplastic prostate tissue.
17624341 Expression of BMP-4 and BMP-7 and their receptors in human ovaries from fetuses as well as adults.
17530716 The presence of BMP-7 and IL-1Ra antagonized the anti-anabolic effects of lipopolysaccharide
17530715 BMP-7 was more potent than BMP-2 in inducing chondrogenesis, but the properties of the differentiated tissue were similar in each case
17522432 induction of BMP7 expression is frequent in melanomas and may serve as a novel prognostic marker of progression in melanoma patients
17497692 BMP7 promotes the adipogenic and not the osteogenic or chondrogenic lineage development of human stem cells
17478078 Proinvasive activity of BMP7 through SMAD4/src-independent and ERK/Rac/JNK-dependent signaling pathways in colon cancer cells is reported.
17415633 Immunohistochemistry of cirrhotic human liver demonstrated upregulated BMP7 protein expression in hepatocytes as compared with normal human liver.
17264867 Observational study of gene-disease association. (HuGE Navigator)
17264867 These results indicate that mutations are rare in FGF8 and FGFR2 in hypospadias, but gene variants may influence the risk.
17262821 strong BMP staining is seen in maturing chondrocytes, and thus may play a role in chondrocyte differentiation and/or apoptosis; BMP release by osteoclasts may promote osteoblastic differentiation at sites of bone remodeling
17018615 BMP7 expression was almost completely absent at the invasive margin of esophageal tumors, but present in the central area. It may antagonize TGF-beta1's role in invasiveness.
17003840 Observational study of gene-disease association. (HuGE Navigator)
16899516 maintenance of renal BMP-7 during the evolution of diabetic nephropathy reduces diabetic renal injury, especially podocyte dropout. The findings also establish a role for endogenous glomerular BMP-7 as an autocrine regulator of podocyte integrity in vivo.
16846353 Recombinant human BMP-7 plays a role in the migration of bone-forming cells.
16831023 Osteogenic protein-1 (OP-1 has shown particular potential in clinical trials as a bone graft substitute .
16807538 BMP-7 expression in the adult human kidney appears to be more restricted than in the fetal situation and predominantly found in the distal nephron.
16719933 Topical and differential expression of BMP-2/4 and BMP-7 mRNA and protein was found in bursa tissue.
16686760 BMP7 could restore the homeostatic balance of pSmad signaling found in normal kidneys, thereby preventing or reversing the development of chronic allograft nephropathy.
16646979 Measurement of OP-1 in joint fluid may have value in the clinical evaluation of joint diseases.
16419056 Our results are suggesting a possible functional role for BMP7 in breast cancer development.
16126463 BMPs influence the formation of the osteolytic prostate cancer metastases, and treatment modalities that inhibit BMP activity may limit the progression of the lytic component of prostate cancer metastases.
15994952 BMP7 induced Smad phosphorylation in a dose-dependent manner, with Smad activation clearly demonstrable in prostate adenocarcinoma.
15929982 the prodomain of BMP-7 has a role in targeting the BMP-7 complex to the extracellular matrix
15861517 To analyze the expression of bone morphogenetic proteins (BMPs) in prostate and breast cancers with established metastasis in bone
15574511 The effect of BMP-7 on TGF-beta1 synthesis in TNF-alpha-stimulated cells was abrogated by disruption of CD44-hyaluronan interactions, suggesting that it was due to increased monocyte binding to hyaluronan on the cell surface.
15100360 Stimulation of kidney cells with BMP-7 induced hyaluronan synthase 2 mRNA expression and decreased the expression of Hyal1 and Hyal2.
14981086 results suggest expression of the Ihh gene, which contains multiple Smad binding sites, may be finely regulated by a gradient of bone morphogenetic protein BMP7
14751565 In the extraskeletal model, newly formed bone was evident in the presence of rhBMP-7
14587033 OP-1 stimulated cell proliferation and mRNA expression of several biochemical markers in this ligament cell culture model
12925612 Modulation of endogenous osteogenic protein-1 (OP-1) by interleukin-1 in adult human articular cartilage.
12919879 Overall decrease in endogenous OP-1 in degenerated and OA tissue suggests that OP-1 could be one of the factors responsible for normal homeostasis and matrix integrity in cartilage.
12811818 BMP-7 plays an important role in the regulation of anti-inflammatory response in the adult gut tissue.
12792780 BMP-7 is expressed in various breast cancer cell lines in a cell line-specific manner
12740218 In pulmonary artery smooth muscle cells from pulmonary hypertension patients, the BMP-2- or BMP-7-induced apoptosis was significantly inhibited compared with PASMCs from patients with secondary pulmonary hypertension.
12734180 IGF-1 and OP-1 could be key physiological regulators of MMP-13 gene expression
12667445 crystal structure of BMP7 in complex with the extracellular domain (ECD) of the activin type II receptor
12594282 BMP-7 inhibits constitutive and IL-1 beta-induced expression of monocyte chemoattractant protein-1 in mesangial cells, partly through suppression of c-Jun N-terminal kinase activity and AP-1 binding activity.
12478660 BMP-7 signaling is inhibited by glypican 3 in hepatocellular carcinoma cells
12478285 crystal structure of the antagonist Noggin bound to BMP-7, which shows that Noggin inhibits BMP signalling by blocking the molecular interfaces of the binding epitopes for both type I and type II receptors
12385776 age related decline in level may contribute to the elevated susceptibility of cartilage to the degenerative process.
11769973 Transforming growth factor-beta1 supports the rapid morphogenesis of heterotopic endochondral bone initiated by human osteogenic protein-1 via the synergistic upregulation of molecular markers

AA Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP      1 - 70
HLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLV     71 - 140
EHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFL    141 - 210
LDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAF    211 - 280
FKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA    281 - 350
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY    351 - 420
RNMVVRACGCH                                                               421 - 431
//

Text Mined References (223)

PMID Year Title
26824865 2016 FoxC2 Enhances BMP7-Mediated Anabolism in Nucleus Pulposus Cells of the Intervertebral Disc.
26695677 2015 [Effect of Homeobox A13 transfection on epithelial-mesenchymal transition and bone morphogenetic protein-7 expression in kidney tubular epithelial cells].
26617798 2015 MicroRNA-137 inhibits cell migration and invasion by targeting bone morphogenetic protein-7 (BMP7) in non-small cell lung cancer cells.
26503415 2015 Lysine-specific demethylase 5C promotes hepatocellular carcinoma cell invasion through inhibition BMP7 expression.
26466853 2015 Effects of heterodimeric bone morphogenetic protein-2/7 on osteogenesis of human adipose-derived stem cells.
26417691 2015 Angiopoietin-like 4 enhances metastasis and inhibits apoptosis via inducing bone morphogenetic protein 7 in colorectal cancer cells.
26385023 2016 Oxygen-glucose deprivation preconditioning protects neurons against oxygen-glucose deprivation/reperfusion induced injury via bone morphogenetic protein-7 mediated ERK, p38 and Smad signalling pathways.
26304754 2015 Bone morphogenetic protein-4 and 7 and receptors regulate vascular endothelial growth factor and receptors in human fetal leptomeninges.
26112332 2015 MiR-22 Suppresses BMP7 in the Development of Cirrhosis.
25716319 2015 Hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype.
25662552 2015 BMP7 Gene involved in nonsyndromic orofacial clefts in Western Han Chinese.
25534037 2015 BMP7 drives human adipogenic stem cells into metabolically active beige adipocytes.
25192984 2015 BMP-7 improved proliferation and hematopoietic reconstitution potential of ex vivo expanded cord blood-derived CD34(+) cells.
25152406 2014 Mesenchymal stem cells from osteoporotic patients reveal reduced migration and invasion upon stimulation with BMP-2 or BMP-7.
25091889 2014 Production of a polyclonal antibody against osteogenic protein-1, and its role in the diagnosis of osteoarthritis.
24970050 2014 Tumour angiogenesis and repulsive guidance molecule b: a role in HGF- and BMP-7-mediated angiogenesis.
24969562 2014 BMP-7 blocks the effects of TGF-?-induced EMT in cholangiocarcinoma.
24820464 2014 Are bone morphogenetic protein-7 (BMP-7) serum levels correlated with development of hepatic fibrosis?
24477555 2014 Bmp 2 and bmp 7 induce odonto- and osteogenesis of human tooth germ stem cells.
24418819 BMP-7 represses albumin-induced chemokine synthesis in kidney tubular epithelial cells through destabilization of NF-?B-inducing kinase.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
24284793 2014 BMP4 and BMP7 induce the white-to-brown transition of primary human adipose stem cells.
24205156 2013 Heterodimeric BMP-2/7 antagonizes the inhibition of all-trans retinoic acid and promotes the osteoblastogenesis.
24190429 2013 Identification of bone morphogenetic protein 7 (BMP7) as an instructive factor for human epidermal Langerhans cell differentiation.
24184479 2013 Bone morphogenetic protein-7 (BMP-7) mediates ischemic preconditioning-induced ischemic tolerance via attenuating apoptosis in rat brain.
24117149 2014 Expression and purification of recombinant human bone morphogenetic protein-7 in Escherichia coli.
24072698 2013 Bone morphogenetic proteins protect pulmonary microvascular endothelial cells from apoptosis by upregulating ?-B-crystallin.
24069261 2013 BMP7 expression correlates with secondary drug resistance in mantle cell lymphoma.
24023033 2014 Bone morphogenetic protein 7 increased vascular endothelial growth factor (VEGF)-a expression in human granulosa cells and VEGF receptor expression in endothelial cells.
23888776 [A novel human bone morphogenetic protein-7 variant with an enriched heparin-binding site].
23853066 2014 Bone morphogenetic protein-2, -6, and -7 differently regulate osteogenic differentiation of human periodontal ligament stem cells.
23825642 2013 Characteristics and stimulation potential with BMP-2 and BMP-7 of tenocyte-like cells isolated from the rotator cuff of female donors.
23747893 2013 BMP-7 counteracting TGF-beta1 activities in organ fibrosis.
23697978 2013 Further evidence of an association between a genetic variant in BMP7 and treatment response to SSRIs in major depressive disorder.
23651239 2013 Vasohibin-1 expression is regulated by transforming growth factor-?/bone morphogenic protein signaling pathway between tumor-associated macrophages and pancreatic cancer cells.
23580474 2013 Nucleus pulposus cells expressing hBMP7 can prevent the degeneration of allogenic IVD in a canine transplantation model.
23539268 2013 Exogenous bone morphogenetic protein-7 reduces hepatic fibrosis in Schistosoma japonicum-infected mice via transforming growth factor-?/Smad signaling.
23504348 2013 BMP7 expression in esophageal squamous cell carcinoma and its potential role in modulating metastasis.
23471555 2013 The anti-fibrotic effect of bone morphogenic protein-7(BMP-7) on liver fibrosis.
23455153 2013 Fine-tuning BMP7 signalling in adipogenesis by UBE2O/E2-230K-mediated monoubiquitination of SMAD6.
23386650 2013 Theca-derived BMP4 and BMP7 down-regulate connexin43 expression and decrease gap junction intercellular communication activity in immortalized human granulosa cells.
23243027 2013 ?Np63?-mediated activation of bone morphogenetic protein signaling governs stem cell activity and plasticity in normal and malignant mammary epithelial cells.
23179403 2013 Prognostic significance of BMP7 as an oncogene in hepatocellular carcinoma.
23132958 2012 Inhibition of osteoclast generation: a novel function of the bone morphogenetic protein 7/osteogenic protein 1.
23126427 2013 Role of the TGF-?/BMP-7/Smad pathways in renal diseases.
23046931 2012 [Effects of rhBMP-7 on osteoblast differentiation of murine bone marrow mesenchymal stem cells in vitro].
22958403 2012 Transforming growth factor ?1 inhibits bone morphogenic protein (BMP)-2 and BMP-7 signaling via upregulation of Ski-related novel protein N (SnoN): possible mechanism for the failure of BMP therapy?
22795855 2012 Osteogenesis induced by a bone forming peptide from the prodomain region of BMP-7.
22778550 2012 The osteogenic study of tissue engineering bone with BMP2 and BMP7 gene-modified rat adipose-derived stem cell.
22720873 2012 Bone morphogenetic protein 7 polarizes THP-1 cells into M2 macrophages.
22674456 2012 BMP induced inflammation: a comparison of rhBMP-7 and rhBMP-2.
22525892 2012 Gremlin-mediated decrease in bone morphogenetic protein signaling promotes aristolochic acid-induced epithelial-to-mesenchymal transition (EMT) in HK-2 cells.
22490392 2012 Induction of superficial zone protein (SZP)/lubricin/PRG 4 in muscle-derived mesenchymal stem/progenitor cells by transforming growth factor-?1 and bone morphogenetic protein-7.
22447022 2012 ?olecular impact of bone morphogenetic protein 7, on lung cancer cells and its clinical significance.
22305102 2012 Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells.
22253716 2012 Bmp7 functions via a polarity mechanism to promote cloacal septation.
22244873 2012 F-spondin regulates the differentiation of human cementoblast-like (HCEM) cells via BMP7 expression.
22212474 2012 Localized expression of human BMP-7 by BM-MSCs enhances renal repair in an in vivo model of ischemia-reperfusion injury.
22209843 2012 Bone morphogenetic protein (BMP)-4 and BMP-7 suppress granulosa cell apoptosis via different pathways: BMP-4 via PI3K/PDK-1/Akt and BMP-7 via PI3K/PDK-1/PKC.
22209770 2012 Development of BMP7-producing human cells, using a third generation lentiviral gene delivery system.
22140272 2012 A genome-wide association study of men with symptoms of testicular dysgenesis syndrome and its network biology interpretation.
22124112 2011 Bone morphogenetic protein 7 in dormancy and metastasis of prostate cancer stem-like cells in bone.
22118688 2011 Analysis of BMP4 and BMP7 signaling in breast cancer cells unveils time-dependent transcription patterns and highlights a common synexpression group of genes.
22099397 BMP-7/TGF-?1 signalling in myoblasts: components involved in signalling and BMP-7-dependent blockage of TGF-?-mediated CTGF expression.
22048752 2012 Impacts of age and gender on bone marrow profiles of BMP7, BMPRs and Stro-1? cells in patients with total hip replacement.
21935711 2012 BMP-7 inhibits TGF-?-induced invasion of breast cancer cells through inhibition of integrin ?(3) expression.
21924665 2011 Bone morphogenetic protein 7: a broad-spectrum growth factor with multiple target therapeutic potency.
21913019 2012 Clinicopathological significance of BMP7 expression in esophageal squamous cell carcinoma.
21898381 2011 Bone morphogenetic proteins inhibit CD40L/IL-21-induced Ig production in human B cells: differential effects of BMP-6 and BMP-7.
21896235 2012 Low gene expression of bone morphogenetic protein 7 in brainstem astrocytes in major depression.
21842277 2011 Mechanical loading stimulates BMP7, but not BMP2, production by osteocytes.
21765909 2011 Transcriptional responses of cultured rat sympathetic neurons during BMP-7-induced dendritic growth.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21644225 2011 [Association of the genetic variations of bone morphogenetic protein 7 gene with diabetes and insulin resistance in Xinjiang Uygur population].
21609526 2011 [Genetic variations of bone morphogenetic protein 7 gene are associated with hypertriglyceridemia of Uygur Chinese in Xinjiang].
21591998 2011 Role of TGF-? and BMP7 in the pathogenesis of oral submucous fibrosis.
21506685 2011 In vitro and in vivo evaluation of adenovirus combined silk fibroin scaffolds for bone morphogenetic protein-7 gene delivery.
21485009 2011 Appropriate Bmp7 levels are required for the differentiation of midline guidepost cells involved in corpus callosum formation.
21458096 2011 Serum bone morphogenetic protein 7, insulin resistance, and insulin secretion in non-diabetic individuals.
21447156 2011 Regulation of chondrocyte gene expression by osteogenic protein-1.
21317922 2011 Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma.
21305726 2010 Bone morphogenetic protein-7 expression in human pyelonephritis.
21224856 2011 Expression of BMP-7 in human gastric cancer and its clinical significance.
21110425 2010 [The relationship of expression of BMP-7 in the liver and hepatic inflammation and fibrosis in patients with chronic HBV infection].
21080950 2010 Bone morphogenetic protein (BMP)-7 expression is decreased in human hypertensive nephrosclerosis.
20952383 2010 Distinct modes of inhibition by sclerostin on bone morphogenetic protein and Wnt signaling pathways.
20932341 2010 Phase 1 safety and tolerability study of BMP-7 in symptomatic knee osteoarthritis.
20887146 2010 Immunogenicity of osteogenic protein 1: results from a prospective, randomized, controlled, multicenter pivotal study of uninstrumented lumbar posterolateral fusion.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20682677 2010 Association of bone morphogenetic proteins with spinal fusion in ankylosing spondylitis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20670444 2010 Association between expression of the bone morphogenetic proteins 2 and 7 in the repair of circumscribed cartilage lesions with clinical outcome.
20656331 2010 Bone morphogenetic protein -7 increases thrombogenicity of lipid-rich atherosclerotic plaques via activation of tissue factor.
20632031 2010 Obliterative airway remodelling in transplanted and non-transplanted lungs.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20573231 2010 Bone morphogenetic protein (BMP)-4 and BMP-7 regulate differentially transforming growth factor (TGF)-beta1 in normal human lung fibroblasts (NHLF).
20546278 2010 Investigation of the association of BMP gene variants with nephropathy in Type 1 diabetes mellitus.
20540029 Bone morphogenetic protein-7 expression is down-regulated in human clear cell renal carcinoma.
20530416 2010 Expression of bone morphogenetic protein 7 in lung cancer and its biological impact on lung cancer cells.
20506283 2010 Bone morphogenetic protein 7 (BMP7) mutations are associated with variable ocular, brain, ear, palate, and skeletal anomalies.
20445470 2010 A prospective, randomized, controlled, multicenter study of osteogenic protein-1 in instrumented posterolateral fusions: report on safety and feasibility.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20188872 2010 The effects of pore architecture in silk fibroin scaffolds on the growth and differentiation of mesenchymal stem cells expressing BMP7.
20126477 2010 Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment.
20085912 2010 Progesterone decreases bone morphogenetic protein (BMP) 7 expression and BMP7 inhibits decidualization and proliferation in endometrial stromal cells.
19950204 2010 The role of BMP-7 in chondrogenic and osteogenic differentiation of human bone marrow multipotent mesenchymal stromal cells in vitro.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
19816049 2010 BMP-7 blocks the cyclosporine-A-induced epithelial-to-mesenchymal transition in renal tubular epithelial cells.
19736306 2010 Endoglin phosphorylation by ALK2 contributes to the regulation of prostate cancer cell migration.
19725097 2010 Enhanced healing of goat femur-defect using BMP7 gene-modified BMSCs and load-bearing tissue-engineered bone.
19597895 2009 Levels of expression for BMP-7 and several BMP antagonists may play an integral role in a fracture nonunion: a pilot study.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19453255 2009 Bone morphogenetic protein 7 (BMP7) gene polymorphisms are associated with inverse relationships between vascular calcification and BMD: the Diabetes Heart Study.
19403392 2009 [Effect of bone morphogenic protein 7 on nephrin expression and distribution in diabetic rat kidneys].
19396502 2009 The synergistic effect of autograft and BMP-7 in the treatment of atrophic nonunions.
19301001 2009 Relationship of plasma and synovial fluid BMP-7 with disease severity in knee osteoarthritis patients: a pilot study.
19283074 2009 Discovery of novel hypermethylated genes in prostate cancer using genomic CpG island microarrays.
19240369 Apoptosis induction and reduced proliferation in human osteoblasts by rhBMP-2, -4 and -7.
19180920 2008 [Relationship between the effect of vascular endothelial growth factor on epithelial-mesenchymal transition of HK-2 cells and the expressions of bone morphogenetic protein-7 and inhibitor of DNA binding/differentiation].
19116903 2009 Effect of interleukin-1beta on osteogenic protein 1-induced signaling in adult human articular chondrocytes.
19112509 2008 BMP-7 does not protect against bleomycin-induced lung or skin fibrosis.
19108831 2010 Bone morphogenetic protein 7 (BMP-7) increases the expression of follicle-stimulating hormone (FSH) receptor in human granulosa cells.
19056781 2009 BMP-7 fails to attenuate TGF-beta1-induced epithelial-to-mesenchymal transition in human proximal tubule epithelial cells.
18980801 2009 BMP7 influences proliferation, migration, and invasion of breast cancer cells.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18621057 2008 A new model for growth factor activation: type II receptors compete with the prodomain for BMP-7.
18560367 2008 Aggressive melanoma cells escape from BMP7-mediated autocrine growth inhibition through coordinated Noggin upregulation.
18514338 2008 Susceptible genes and molecular pathways related to heavy ion irradiation in oral squamous cell carcinoma cells.
18508541 2008 Bone morphogenetic protein-7 (BMP7) in chronic kidney disease.
18496506 2008 BMP-7 protects mesangial cells from injury by polymeric IgA.
18465455 Relationship of bone morphogenetic proteins to disease activity and radiographic damage in patients with ankylosing spondylitis.
18437684 2008 Involvement of FGF and BMP family proteins and VEGF in early human kidney development.
18436533 2008 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
18393351 2008 Bone morphogenetic protein-7 regulates differentially the mRNA expression of bone morphogenetic proteins and their receptors in rat achilles and patellar tendon cell cultures.
18349123 2008 Bone morphogenetic proteins are overexpressed in the bone marrow of primary myelofibrosis and are apparently induced by fibrogenic cytokines.
18339631 2008 Targeting of bone morphogenetic protein growth factor complexes to fibrillin.
18328806 2008 DeltaNp63/BMP-7-dependent expression of matrilin-2 is involved in keratinocyte migration in response to wounding.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18292470 2008 Basal expression of bone morphogenetic protein receptor is reduced in mild asthma.
18259822 2008 Clinical significance of BMP7 in human colorectal cancer.
18184661 2008 Bone morphogenetic proteins signal through the transforming growth factor-beta type III receptor.
18032587 2008 A human bone morphogenetic protein antagonist is down-regulated in renal cancer.
18029192 2007 Bone morphogenetic protein (BMP)-7 but not BMP-2 and BMP-4 improves maintenance of primitive peripheral blood-derived hematopoietic progenitor cells (HPC) cultured in serum-free medium supplemented with early acting cytokines.
17977014 2008 Expression and characterization of a human BMP-7 variant with improved biochemical properties.
17909016 2007 Targeted repression of bone morphogenetic protein 7, a novel target of the p53 family, triggers proliferative defect in p53-deficient breast cancer cells.
17724140 2007 BMP7, a putative regulator of epithelial homeostasis in the human prostate, is a potent inhibitor of prostate cancer bone metastasis in vivo.
17656261 2007 Bone morphogenic factor gene dosage abnormalities in prostatic intraepithelial neoplasia and prostate cancer.
17624341 2008 Expression of bone morphogenetic proteins 4 and 7 and their receptors IA, IB, and II in human ovaries from fetuses and adults.
17530716 2007 Toll-like receptors and chondrocytes: the lipopolysaccharide-induced decrease in cartilage matrix synthesis is dependent on the presence of toll-like receptor 4 and antagonized by bone morphogenetic protein 7.
17530715 2007 Chondrogenic differentiation of bovine synovium: bone morphogenetic proteins 2 and 7 and transforming growth factor beta1 induce the formation of different types of cartilaginous tissue.
17522432 2007 Bone morphogenetic protein 7 (BMP7) expression is a potential novel prognostic marker for recurrence in patients with primary melanoma.
17497692 2007 BMP7 promotes adipogenic but not osteo-/chondrogenic differentiation of adult human bone marrow-derived stem cells in high-density micro-mass culture.
17478078 2007 Proinvasive activity of BMP-7 through SMAD4/src-independent and ERK/Rac/JNK-dependent signaling pathways in colon cancer cells.
17415633 2007 Bone morphogenetic protein 7 is elevated in patients with chronic liver disease and exerts fibrogenic effects on human hepatic stellate cells.
17264867 2007 FGFR2, FGF8, FGF10 and BMP7 as candidate genes for hypospadias.
17262821 2007 Immunohistochemical localization of bone morphogenetic proteins (BMPs) 2, 4, 6, and 7 during induced heterotopic bone formation.
17244894 2007 Antagonistic effects of bone morphogenetic protein-4 and -7 on renal mesangial cell proliferation induced by aldosterone through MAPK activation.
17018615 2006 In vivo and in vitro evidence for transforming growth factor-beta1-mediated epithelial to mesenchymal transition in esophageal adenocarcinoma.
17003840 2007 Mutation screening of BMP4, BMP7, HOXA4 and HOXB6 genes in Chinese patients with hypospadias.
16899516 2006 Renal bone morphogenetic protein-7 protects against diabetic nephropathy.
16846353 2006 Chemotactic migration of human mesenchymal stem cells and MC3T3-E1 osteoblast-like cells induced by COS-7 cell line expressing rhBMP-7.
16831023 2006 Osteogenic protein-1 : a review of its utility in spinal applications.
16807538 2006 Bone morphogenetic protein-7 expression and activity in the human adult normal kidney is predominantly localized to the distal nephron.
16719933 2006 Expression of bioactive bone morphogenetic proteins in the subacromial bursa of patients with chronic degeneration of the rotator cuff.
16686760 2006 Chronic allograft nephropathy: intraepithelial signals generated by transforming growth factor-beta and bone morphogenetic protein-7.
16646979 2006 Osteogenic protein 1 in synovial fluid from patients with rheumatoid arthritis or osteoarthritis: relationship with disease and levels of hyaluronan and antigenic keratan sulfate.
16419056 2006 Bone morphogenetic protein 7 is widely overexpressed in primary breast cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16325379 2006 A novel role for the choroid plexus in BMP-mediated inhibition of differentiation of cerebellar neural progenitors.
16126463 2006 Overexpression of noggin inhibits BMP-mediated growth of osteolytic prostate cancer lesions.
16049014 2005 Identification of receptors and signaling pathways for orphan bone morphogenetic protein/growth differentiation factor ligands based on genomic analyses.
15994952 2005 Diverse biological effect and Smad signaling of bone morphogenetic protein 7 in prostate tumor cells.
15929982 2005 The prodomain of BMP-7 targets the BMP-7 complex to the extracellular matrix.
15861517 2005 Expression of bone morphogenetic proteins in human metastatic prostate and breast cancer.
15574511 2005 Bone morphogenic protein-7 inhibits monocyte-stimulated TGF-beta1 generation in renal proximal tubular epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15100360 2004 BMP-7 modulates hyaluronan-mediated proximal tubular cell-monocyte interaction.
15020244 2004 USAG-1: a bone morphogenetic protein antagonist abundantly expressed in the kidney.
14981086 2004 Indian hedgehog gene is a target of the bone morphogenetic protein signaling pathway.
14751565 2004 Bone formation in the presence of platelet-rich plasma vs. bone morphogenetic protein-7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679171 2003 Epithelial-mesenchymal transition and its implications for fibrosis.
14660436 2004 A novel chordin-like BMP inhibitor, CHL2, expressed preferentially in chondrocytes of developing cartilage and osteoarthritic joint cartilage.
14623234 2003 Identification of a secreted BMP antagonist, ectodin, integrating BMP, FGF, and SHH signals from the tooth enamel knot.
14587033 2003 Effects of osteogenic protein-1 (OP-1, BMP-7) on gene expression in cultured medial collateral ligament cells.
14517293 2003 Myostatin signals through a transforming growth factor beta-like signaling pathway to block adipogenesis.
12925612 2003 Modulation of endogenous osteogenic protein-1 (OP-1) by interleukin-1 in adult human articular cartilage.
12919879 2003 Alterations in endogenous osteogenic protein-1 with degeneration of human articular cartilage.
12811818 2003 Bone morphogenetic protein-7 reduces the severity of colon tissue damage and accelerates the healing of inflammatory bowel disease in rats.
12792780 2003 Differential expression and regulation of bone morphogenetic protein 7 in breast cancer.
12741987 2003 A role for BMP heterodimers in roof plate-mediated repulsion of commissural axons.
12740218 2003 Bone morphogenetic proteins induce apoptosis in human pulmonary vascular smooth muscle cells.
12734180 2003 Inhibitory effects of insulin-like growth factor-1 and osteogenic protein-1 on fibronectin fragment- and interleukin-1beta-stimulated matrix metalloproteinase-13 expression in human chondrocytes.
12667445 2003 The BMP7/ActRII extracellular domain complex provides new insights into the cooperative nature of receptor assembly.
12631064 2003 Evidence that bone morphogenetic protein 4 has multiple biological functions during kidney and urinary tract development.
12594282 2003 Bone morphogenetic protein-7 inhibits constitutive and interleukin-1 beta-induced monocyte chemoattractant protein-1 expression in human mesangial cells: role for JNK/AP-1 pathway.
12478660 2003 Glypican-3, overexpressed in hepatocellular carcinoma, modulates FGF2 and BMP-7 signaling.
12478285 2002 Structural basis of BMP signalling inhibition by the cystine knot protein Noggin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12385776 2002 Age-related changes in cartilage endogenous osteogenic protein-1 (OP-1).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11769973 2001 Transforming growth factor-beta1 supports the rapid morphogenesis of heterotopic endochondral bone initiated by human osteogenic protein-1 via the synergistic upregulation of molecular markers.
11580864 2001 Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons.
11502704 2001 Altered growth responses of pulmonary artery smooth muscle cells from patients with primary pulmonary hypertension to transforming growth factor-beta(1) and bone morphogenetic proteins.
11472891 2001 Characterization of human bone morphogenetic protein (BMP)-4 and -7 gene promoters: activation of BMP promoters by Gli, a sonic hedgehog mediator.
11401538 2001 The 5' flanking region of the human bone morphogenetic protein-7 gene.
10912525 2000 Bone morphogenetic proteins and skeletal development: the kidney-bone connection.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9748228 1998 Specific activation of Smad1 signaling pathways by the BMP7 type I receptor, ALK2.
9693150 1998 Regulation of BMP7 expression during kidney development.
9311995 1997 TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8605097 1996 Bone morphogenetic protein type IB receptor is progressively expressed in malignant glioma tumours.
8570652 1996 Three-dimensional structure of recombinant human osteogenic protein 1: structural paradigm for the transforming growth factor beta superfamily.
8297380 1994 Localization of osteogenic protein-1 (bone morphogenetic protein-7) during human embryonic development: high affinity binding to basement membranes.
8006002 1994 Identification of type I receptors for osteogenic protein-1 and bone morphogenetic protein-4.
7791754 1995 Human type II receptor for bone morphogenic proteins (BMPs): extension of the two-kinase receptor model to the BMPs.
7560881 1995 Expression pattern of osteogenic protein-1 (bone morphogenetic protein-7) in human and mouse development.
2357959 1990 OP-1 cDNA encodes an osteogenic protein in the TGF-beta family.
2263636 1990 Identification of transforming growth factor beta family members present in bone-inductive protein purified from bovine bone.
1427904 1992 A bone morphogenetic protein subfamily: chromosomal localization of human genes for BMP5, BMP6, and BMP7.