Property Summary

NCBI Gene PubMed Count 37
PubMed Score 81.41
PubTator Score 36.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.400 3.4e-04
Breast cancer -1.800 7.6e-18
colon cancer -3.100 1.7e-07
ependymoma 2.300 1.6e-03
interstitial cystitis -2.200 8.5e-03
lung adenocarcinoma -1.400 6.0e-07
lung cancer -1.900 4.2e-03
lung carcinoma -3.100 1.4e-19
malignant mesothelioma 2.500 1.5e-06
non-small cell lung cancer -2.161 4.7e-18
sonic hedgehog group medulloblastoma 1.600 7.4e-03

Protein-protein Interaction (3)

Gene RIF (20)

AA Sequence

MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSP      1 - 70
GKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSP     71 - 140
PLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFE    141 - 210
NETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRS    211 - 280
INVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQK    281 - 350
QACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA    351 - 420
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH                                        421 - 454
//

Text Mined References (38)

PMID Year Title