Property Summary

NCBI Gene PubMed Count 31
PubMed Score 130.53
PubTator Score 55.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6514 1.9e-26
colon cancer 1428 2.0e-09
lung adenocarcinoma 2627 1.7e-07
ulcerative colitis 1765 1.7e-06
interstitial cystitis 2237 1.5e-03
lung cancer 4607 2.4e-03
osteosarcoma 7766 8.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Refractive error 50 0.0 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -4.700 2.0e-09
interstitial cystitis -1.400 1.5e-03
lung adenocarcinoma -1.100 1.7e-07
lung cancer -1.700 2.4e-03
osteosarcoma 1.522 8.7e-03
psoriasis -1.700 1.9e-26
ulcerative colitis -1.100 1.7e-06

 MGI Phenotype (1)

 GWAS Trait (2)

Gene RIF (14)

AA Sequence

MAGASRLLFLWLGCFCVSLAQGERPKPPFPELRKAVPGDRTAGGGPDSELQPQDKVSEHMLRLYDRYSTV      1 - 70
QAARTPGSLEGGSQPWRPRLLREGNTVRSFRAAAAETLERKGLYIFNLTSLTKSENILSATLYFCIGELG     71 - 140
NISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLLGHLSVDMAKSHRDIMSWLSKDITQLLRKAK    141 - 210
ENEEFLIGFNITSKGRQLPKRRLPFPEPYILVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAA    211 - 280
LSIERRKKRSTGVLLPLQNNELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQ    281 - 350
FDEQTLKKARRKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQ    351 - 420
SIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR                      421 - 472
//

Text Mined References (33)

PMID Year Title