Property Summary

NCBI Gene PubMed Count 502
PubMed Score 4267.50
PubTator Score 2601.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Refractive error 43 0.0 2.0

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -8.300 3.2e-09
astrocytic glioma 2.600 1.6e-03
ependymoma 2.600 3.9e-03
oligodendroglioma 3.600 2.3e-03
esophageal adenocarcinoma 1.300 1.8e-02
cutaneous lupus erythematosus -1.400 6.1e-03
psoriasis -1.600 6.6e-04
glioblastoma 1.200 4.1e-02
osteosarcoma 2.013 9.9e-03
Atopic dermatitis -1.300 4.0e-05
non-small cell lung cancer -2.204 2.1e-13
intraductal papillary-mucinous neoplasm ... 2.000 3.0e-02
colon cancer -2.900 3.2e-05
lung cancer -3.700 2.3e-06
active Crohn's disease -1.194 1.4e-02
interstitial cystitis -2.700 1.4e-03
pediatric high grade glioma 1.500 4.1e-03
group 4 medulloblastoma -1.500 6.6e-04
pilocytic astrocytoma 2.000 6.3e-09
lung adenocarcinoma -1.482 1.1e-03
nasopharyngeal carcinoma 1.200 1.3e-02
lung carcinoma -1.300 1.4e-07
spina bifida -1.068 4.0e-02
ductal carcinoma in situ -2.500 4.4e-04
invasive ductal carcinoma -2.700 2.9e-03
ovarian cancer -3.300 1.0e-19

 GWAS Trait (1)

Gene RIF (431)

PMID Text
26845276 detected a joint effect of SNP and G x E interaction in BMP2 and CACNA2D1 for depressive state.
26808122 combination of adenoviral mediated BMP-2 expression in BMSC grown in the newly developed poly(LLA-co-CL) scaffolds induced expression of osteogenic markers and enhanced bone formation in vivo
26636769 The findings in this study provide new insights into the regulatory mechanism of BMP-2 induction in leptin-stimulated chondrocytes and suggest that BMP-2 may play a reparative role in regulating leptin-induced OA development.
26621735 results explain why BMP2 suppresses growth in vitro and promotes growth in vivo. Together, our results support BMP2 as a therapeutic target in ovarian cancer
26563344 ata show that dedifferentiated chondrocytes can be redifferentiated following treatment with the chimeric erythroid differentiation factor (activin A)/bone morphogenetic protein 2 (BMP2) ligand AB235.
26494778 BMP-2 has dual activity, inducing osteogenic and adipogenic differentiation, subject to hASC donor line studied
26491693 These results suggest that a combination of d-BCP and rhBMP2 can accelerate bone regeneration, and this could be used to develop therapeutic strategies in hard tissue healing.
26466853 Heterodimeric BMP-2/7 significantly promoted osteogenesis of human adipose-derived stem cells in vitro and in vivo. However, BMP-2/7 was not found to be a stronger inducer of osteogenesis compared to homodimeric either BMP-2 or BMP-7.
26460254 study analyzed BMP2 gene in non-HFE haemochromatosis patients; taken together we postulate that BMP2 rs235768 is a new susceptibility factor for haemochromatosis; it can contribute to iron overload in association with other genetic and environmental factors
26413886 An imbalance between BMP-2 and Noggin secretion induces abnormal osteogenic differentiation of ankylosing spondylitis-mesenchymal stem cells.
26400336 Compared with bone graft and marrow cavity contents, sticking scars had the highest expression of BMP-2 while bone grafts had the highest expression of DCN.
26308798 NF-kappaB stimulates BMP-2 mRNA expression in rat and human beta cells upon IL-1b cytokine exposure.
26292283 Over-expression of BMP-2 in human articular cartilage progenitor cells , independent of load, led to an increase in markers associated with hypertropy.
26124007 our results suggest that the BMP-2 induced STAT3-mediated induction of colon cancer cell metastasis requires an EMT and/or changes in cancer stem cell markers
26047580 data suggest a possible mechanism by which the elevation of beta-catenin resulting from BMP2 stimulation is mediated by the p38 MAPK pathway, which sheds light on the molecular mechanisms of BMP2-mediated pulp reparative dentin formation
26003174 Patients with T2DM had higher circulating levels of BMP-2 than normal controls. Plasma BMP-2 levels correlated positively with atherosclerotic plaque burden and coronary calcification in patients with T2DM.
25996180 ovariectomy and corticosteroid-induced osteoporosis significantly undermines rhBMP-2 osteoinductivity.
25976471 Single nucleotide polymorphisms in HAMP, BMP2, FTL and SLC40A1 genes have phenotype-modifying roles in hereditary hemochromatosis type 1.
25938661 These results show how repulsive guidance molecule acts as the central hub that links BMP2 and NEO1 and physically connects these fundamental signaling pathways.
25924783 BMP2 expression in human lung fibroblasts has a role in lung adenocarcinomas
25920311 The investigation also shows lack of correlation of 570A>T and 5375G>A BMP2 polymorphisms polymorphisms with analysed clinical and bone turnover parameters.
25917422 Hydrogel-rhBMP-2 hybrid delivery system improved bone formation and restoration of biomechanical function of rat segmental bone defects compared with autograft treatment.
25837159 These results demonstrate that estrogen signaling in osteoblasts negatively regulates SOST expression in an indirect manner through interaction with BMP2 signaling.
25817394 Report long-term controlled delivery of rhBMP-2 from collagen-hydroxyapatite scaffolds for superior bone tissue regeneration.
25814267 hBMP-2 and hTGF-beta1 can synergistically improve the bone repair process. Our results suggest a potential clinical value of combining hBMP-2 and hTGF-beta1 in repairing bone defects.
25797254 High BMP-2 mRNA expression was associated with advanced tumor stage and lymph node involvement and lower BMP-2 mRNA with poor overall survival post-nephrectomy. In RCC cells, BMP-2 inhibited cell proliferation, migration, invasion, and colony formation.
25776852 much effort has been devoted to identifying the molecules and conditions that influence BMP2 synthesis and the complex mechanisms that control Bmp2 gene expression.
25705677 Increased localization of BMP-2 protein and expression of osteocalcin were observed within defects, suggesting accumulation of endogenous BMP-2 and/or increased de novo expression of BMP-2 protein within sites undergoing bone repair by AMOR
25698539 C23 protein meditates bone morphogenetic protein-2-mediated epithelial-to-mesenchymal transition via up-regulation of Erk1/Erk2 and Akt in gastric cancer.Correlations between C23, BMPRII expression and prognosis of gastric cancer patients.
25681461 Data suggest that the up-regulation of bone morphogenetic protein 2 (BMP-2) and SRY-9 transcription factor in chondrocytes may play a key role in preventing cytoskeletal alterations.
25668064 This approach is suitable for achieving controlled and sustained local delivery of BMP-2 and other growth factors.
25656933 this study demonstrates that Ca(2+) activates the BMP2-mediated Smad1/5/8 and Erk1/2 pathways in DPSCs and that Smad1/5/8 and Erk1/2 signaling converge at Runx2 to control the odontoblastic differentiation of DPSCs
25644704 BMP2 levels in serum and synovial fluid are closely related to the radiographic and symptomatic severity of knee osteoarthritis
25640452 Results demonstrate failure of BMP-2 signaling in osteoporotic mesenchymal stem cells.
25601208 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response
25562153 BMP-2 plays a crucial role in calcium deposition in VSMCs and VC in CKD patients via a mechanism involving the Wnt/b-catenin pathway
25448881 Our study lays a new foundation for the treatment of gastric cancer through antagonizing BMP2 system.
25431339 BMP-2 inhibits the tumor-initiating ability of renal CSCs and induces osseous bone formation.
25430711 Overexpression of COMP inhibits BMP-2-induced osteogenic differentiation and promotes BMP-2-induced chondrogenic differentiation.
25412776 Biglycan upregulates BMP-2 and TGF-beta 1 in human aortic valve cells through Toll-like receptors. Both BMP-2 and TGF-beta 1 are required for aortic valve cell pro-osteogenic reprogramming.
25391427 Five single nucleotide polymorphisms (SNP) in the BMP2 gene were genotyped.
25378054 Gremlin1 preferentially binds to BMP-2 and BMP-4 over BMP-7.
25359431 It is suggested that oxytalan-positive POFs, purportedly originating from the periodontal ligament, express molecules that are specific to bone and cementum (Runx-2, BMP-2), or cementum only (CAP).
25350918 PC5/6A is involved in squamous differentiation of human nasal epithelial cells, possibly through up-regulation of the BMP-2 signaling pathway.
25329960 These results suggest that COMP-Ang1 preserved the necrotic femoral head through the potentiation of BMP-2 signaling pathways and angiogenesis.
25301360 BMP2 stimulated osteogenic differentiation of hADSCs.
25191703 BMP2 gene variant of rs2273073 (T/G) can not only increase individual susceptibility to OPLL, but also increase the sensibility to mechanical stress which may play an important role during the pathological process of OPLL.
25152406 HMSC from osteoporotic patients showed a significant increase of migration upon BMP-2 or FCS stimulation, as well as a significant increase of invasion upon BMP-2, BMP-7 or FCS stimulati
25099618 High BMP2 expression is associated with glioma.
25099263 pHEMA-nHA-vancomycin preabsorbed with rhBMP-2 may be useful in the repair of critical-size long bone defects prone to infections.
25070743 The results suggested that lentiviral-mediated BMP2 gene transfection enhances the odontogenic differentiation capacity of human stem cells from the apical papilla in vitro.
25027287 Data (including data involving bovine ectogenesis and recombinant human BMP2) suggest that BMP2 plays minimal role in up-regulation of mRNA for specific proteins that occurs during oocyte maturation and embryonic development to blastocyst stage.
24954001 oxidized-irradiated alginate hydrogels would elicit an accelerated release of BMP-2, but degrade faster in vivo, facilitating the formation of higher quality, more mature bone compared to irradiated alginate.
24946687 BMP-2 silencing can significantly inhibit non-small lung cancer cell proliferation and migration.
24942379 data support that the presentation of BMP-2 on the surface of nanofibers as immobilized by utilizing polydopamine chemistry may be an effective method to direct bone growth at relatively low local concentration.
24928442 miR-140-5p functionally inhibits osteogenic lineage commitment in undifferentiated hMSC
24885555 These results provide evidence for an important contribution of the BMP2-PI3K (p55gamma/p110alpha)- PIP3-LL5beta signalling axis in mesenchymal progenitor cell chemotaxis.
24828823 These compounds increased BMP-2 signal responsiveness.
24814649 BMP-2 and -4 are produced by vascular smooth muscle cells in atherosclerotic lesions and induce monocyte chemotaxis through direct BMPRII activation
24804200 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24783213 Heterotopic bone was engineered in vivo around vessels using different rhBMP-2 and TG-VEGF ratios in a fibrin matrix injected into a dimensionally stable membrane tube which prevented direct contact with skeletal muscles.
24764222 results suggest that the positive effect of the combination of EGF and rhBMP-2 is expected to induce the bone formation earlier compared to the single use of rhBMP-2 in vitro and in vivo.
24764177 the use of a HCF system loaded with ErhBMP-2 may reduce adipose tissue formation and enhance mineralized tissue formation.
24743742 TNF-alpha/IL-1beta- and BMP-2-activated p38 and ERK1/2 signaling have opposing roles that converge on Runx2 to regulate osteoblastic differentiation.
24742993 studies show that Shh, BMP2 and COL1 protein expression is decreased in trisomy 18 amniocytes compared to normal amniocytes.
24737472 These results suggest that these SNPs of BMP-2 and COL6A1 may not directly influence the expression of OPLL.
24723453 Coleusin factor represents a new type of BMP-2 inducer that restores differentiation in osteosarcoma cells.
24710560 BMP2 is the causing gene for BDA2
24682653 Human recombinant BMP2 induced neurite outgrowth from cultured rat ventral midbrain DA neurons. This is dependent on BMP type I receptor activation of the Smad 1/5/8 signalling pathway.
24643989 Rln enhanced synergistically BMP-2-induced osteoblast differentiation and bone formation.
24639043 osteogenic induction by the sequential delivery of BMP-2 followed by FGF-2 from core-shell microspheres was even worse than that from microspheres loaded with BMP-2 in both core and shell, although comparable to the cases of parallel delivery of dual GFs
24601881 Data suggest BMP2 stimulates SMAD2/3 signaling in gonadotrophs via Bmpr1a (bone morphogenetic protein receptor type 1A); such signaling via SMAD3 appears to be necessary for up-regulation of Fshb (follicle stimulating hormone beta) transcription.
24585058 Findings suggest that suppression of BMP2 by epigenetic silencing may play a critical role in the genesis of rhabdomyosarcoma.
24573607 suggest that BMP-2 exerts an inhibitory effect on the growth and migration of hepatocellular carcinoma cells, possibly via a blockade of PI3K/AKT signaling
24561081 cyclic tensile force activates ERK1/2 and p38 MAP kinase signaling pathways, and induces COX-2 expression, which is responsible for the sequential PGE2 biosynthesis and release, and mediates the increase in BMP-2 expression at the transcriptional level.
24551273 BMP2, is elevated in the stenotic colon segment of Hirschsprung disease patients, and BMP2 signaling may play a pivotal role in disease development.
24551211 Sox9 potentiates BMP2-induced chondrogenic differentiation and inhibits BMP2-induced osteogenic differentiation.
24492129 Rare variants in BMP2 and BMP4 are not a major genetic component in the otosclerosis population. However, those with functional affect showed decreased Smad signaling.
24477555 Both BMP2 and BMP7 promote odontogenic and osteogenic differentiation of human tooth germ stem cells.
24477081 Recombinant human rhBMP-2 use and location of rhBMP-2 use in adult spinal deformity surgery, at reported doses, do not increase acute major, neurological, or wound complications.
24409810 JNK activity is required for late-stage odontoblastic differentiation induced by BMP-2
24406215 CCN3 can promote dentinogenesis by coordinating proliferation and odontoblastic differentiation of dental pulp stem cells via modulating Notch and BMP2 signaling pathways.
24393182 Radiographic union is consistent with published rates for nonunion repair of scaphoid, phalanx, and distal radius fractures; however, treatment with recombinant BMP-2 did not produce superior rates of union in patients with wrist and hand nonunion.
24387671 In adamantinomatous craniopharyngioma, Bmp2 was expressed primarily in the stellate reticulum and whorl-like array cells; Runx2 and Osterix tended to be expressed in calcification-related epithelia.
24339730 Specific gene siRNAs knock-down further confirmed the osteogenic effects of Genistein on BMP2, SMAD5 and RUNX2 protein expression
24321094 In conclusion, results of our study suggest that the NOTCH-signaling pathway, which is activated during the osteogenic differentiation of DFCs.
24288199 Inhibition of rhBMP-2-induced ALP activity by intracellular delivery of SMURF1 in murine calvarial preosteoblast cells.
24269858 Recombinant human bone morphogenetic protein-2 (rhBMP-2) use during an anterior or transforaminal lumbar interbody fusion technique is associated with an increased risk of neurological deficit and anterior thigh/groin pain.
24266740 Spatial distribution of newly formed bone is more uniform in gelatin-coated scaffolds of BMP-2 than in uncoated scaffolds, which display preferential bone formation at the periphery.
24247005 Head and neckk squamous cell carcinomas with high baseline BMP-2 protein level are associated with higher rates of local recurrence.
24205156 50 ng/ml BMP-2/7 could antagonize ATRA and significantly enhance the mineralization.
24175816 Serum BMP-2 up-regulation is associated with advanced non-small cell lung cancer.
24153173 Use of recombinant BMP-2 may unnecessarily increase the risk of complication in routine lumbar interbody fusion procedures.
24100446 Using primary cells and a cell line mimicking CP-CML, we found that myeloid progenitor expansion is driven by the exposure of immature cells overexpressing BMP receptor Ib to BMP2 and BMP4.
24077220 Data suggest that MMP10 (matrix metallopeptidase 10) promotes differentiation of myoblasts into osteoblasts by up-regulating BMP2/Smad6/Smad7 signaling pathway and gene expression of proteins found in bone (collagen, type I; osterix; osteocalcin).
24060635 JNK and GSK3 especially are potential signaling molecules regulating BMP-induced osteoblastic human mesenchymal stem cells differentiation.
24008158 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Tat induces significantly higher secretion of BMP-2 and BMP-7 ligands when compared with that of untreated cells
23977328 the released BMP-2 directs osteogenic differentiation in vitro and in vivo.
23977305 BMP signaling was stimulated in adipose derived stem cells (ASCs) by downregulating noggin.
23918166 Results indicate that BMP/Smad signaling pathway was altered during the period of osteogenesis, and that the activities of p-Smad1/5 were required for Saos-2 cells viability and differentiation induced by fluoride.
23916851 BMP-2 regulates Sdf-1alpha/CXCR4 signaling mediating digit tip regeneration.
23901942 BMP-2 plasmid DNA-based gene therapy in alginate is a promising new strategy for BMP-2 administration for bone (re)generation.
23900689 BMP-2 induces bone formation in heterogeneous osteosarcoma cells and BMP-2 may have a promising therapeutic role for treating human osteosarcoma by inducing differentiation along an osteogenic pathway
23853066 determined whether BMP-2, -6, and -7 differentially regulate the proliferation, mineralization, and mRNA expression of bone/mineralized tissue associated genes of human periodontal ligament stem cells obtained from periodontal ligament tissue
23825642 stimulation potential with BMP-2 and BMP-7 of tenocyte-like cells
23790163 Osteogenic potential of BMP-2-releasing self-assembled membranes.
23784946 These data indicate a synergistic crosstalk between 1alpha,25(OH)2D3 and BMP2 toward osteogenesis and mineral deposition, involving both VDR and Pdia3.
23716395 Inhibition of BMP activity protects epithelial barrier function in lung injury.
23708553 the BMP pathway is involved in calcitonin gene-related peptide-induced osteogenic differentiation but not in proliferation, whereas the cAMP/pCREB pathway is involved in the expression of BMP-2.
23537995 This Bmp2 nsSNP will cause changes in the protein structure.
23528838 This study demonstrates that COMP enhances the osteogenic activity of BMP-2, both in-vitro and in-vivo.
23506588 The Smad mediated signaling pathway plays an important role during the pathological process of OPLL induced by SNPs of BMP-2 gene
23461810 Heparin-conjugated fibrin long-term delivery system with low dose of BMP-2 (10 mug) is ineffective for the induction of lumbar posterolateral fusion in the rabbits.
23429681 Suggest that the in vivo host response to rhBMP-2 in a rat model may be associated with circulating proinflammatory and osteoclastic cytokines.
23423222 Gene expression changes due to neurofibromin modulation but independent of NRAS and MEK1/2 regulation in malignant peripheral nerve sheath tumor cells indicated bone morphogenetic protein 2 (Bmp2) signaling as a key pathway.
23360788 A high-concentration BMP2 decreases human periosteal cell proliferation and induces apoptosis via the activation of Wnt inhibitors DKK1 and SOST.
23359411 BMP-2 pre-conditioning significantly increases osteogenic differentiation of adipose tissue-derived mesenchymal stem (ASC) cells but the effects are significantly smaller than those observed for (TNF)-alpha preconditioning.
23341458 Data indicate that FSAP mediates proteolytic cleavage and activation of bone morphogenetic protein-2 (BMP-2).
23313904 The method is demonstrated using BMP-2 proteins on C2C12 cells as a model system.
23276457 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23239467 64% of the Wnt signaling components regulated by demineralized bone powder were regulated similarly by the sum of effects by BMP-2 and by TGF-beta1.
23192572 Local administration of VEGF and rhBMP-2 augments angiogenesis, osteoblastic activity and bone blood flow from implanted blood vessels of donor origin in vascularized bone allografts
23161572 Single-nucleotide polymorphisms in BMP2 gene is associiated with colorectal cancer.
23160099 Robust associations with nonsyndromic sagittal craniosynostosis were found in a 120-kb region downstream of BMP2 flanked by rs1884302 and rs6140226 and within a 167-kb region of BBS9 between rs10262453 and rs17724206.
23150675 MTMR4 is a necessary negative modulator for the homeostasis of BMP/Dpp signaling
23142810 Studies uncovered a linear pathway involving BMP2, WNT4/beta-catenin, and Forkhead box protein O1 that operates in human endometrium to critically control decidualization.
23122408 The kinetics of the folding and dimerization of human BMP-2.
23088504 Therefore, cell-specific ECMs are capable of modulating the BMP-2-induced osteogenic and chondrogenic differentiation of hMSCs.
23079991 This was the first time that BMP2 and BMP4 single nucleotide polymorphisms were observed in Mexican oligodontia families.
23023810 Effects of recombinant human bone morphogenic protein-2 and human bone marrow-derived stromal cells on in vivo bone regeneration of chitosan-poly(ethylene oxide) hydrogel.
23017834 Data indicate that LvNELL1 infection promoted the osteogenic differentiation of hADSCs, and the effect was comparable with that of LvBMP2.
23010719 SHP is a downstream factor of BMP2 signaling in odontoblasts and may stimulate dentin matrix mineralization via enhancing the transcriptional activity of Dlx5.
22965927 We report on a multigenerational family with a history of cleft palate as a result of a 2.3 Mb deletion of chromosome 20p12.3, including the BMP2 gene.
22961954 In vitro and in vivo studies of rhBMP2-coated PS/PCL fibrous scaffolds for bone regeneration.
22958403 Recombinant TGFbeta1 effectively blocks recombinant BMP-2 and BMP-7 signaling in osteoblasts.
22894570 More importantly, 3D micro-computed tomography images enabled the visualization of a well-contained newly formed bone at ipsilateral implant sites with surface functionalized rhBMP-2 delivery.
22886971 UPB scaffolds sequentially exhibited burst and sustained release of rhBMP2.
22791809 Increased expression and activity of the BMP pathway accompanied by CDX2 upregulation and SOX2 downregulation were observed in AGS cells co-cultured with H. pylori or BMP2
22778550 Results demonstrated that it was advantageous to construct tissue engineering bone using ADSCs cotransfected with BMP2 and BMP7 on beta-TCP.The results showed the BMP2 and BMP7 genes cotransfection group dramatically enhanced new bone formation.
22771956 These results demonstrated a novel role of SDF-1 signaling in regulating BMP2-induced chondrogenic differentiation in vitro.
22674456 BMP2 and BMP7 have roles in inflammation, but BMP7 has a greater role in soft tissue edema
22652796 hypothesized that BMP2 promotes cancer metastasis by modulating MMP-2 secretion and activity through intracellular ROS regulation and ERK activation in pancreatic cancer
22652428 Recombinant human bone morphogenetic protein-2 released from polyurethane-based scaffolds promotes early osteogenic differentiation of human mesenchymal stem cells
22583106 Mutation of a cleavage site adjacent to the mature domain leads to increase in secreted mature BMP-2 with reduced activity
22542719 Data show that bone morphogenetic protein-2 (BMP-2) significantly increased in serum of patients who had urinary tract infection (UTI) and renal stone.
22540193 Study found that BMP2 stimulation and mechanical load synergistically regulate immediate early phosphorylation events in the BMP pathway in human fetal osteoblasts.
22496405 Adult renal progenitor cells express BMP-2, which may induce their commitment toward a myofibroblastic phenotype in vitro and in vivo; this profibrotic effect is mediated by Nox4 activation.
22366399 Ubc9 negatively regulates osteoblastic differentiation induced by BMP.
22359486 Recombinant human BMP-2 exerted an inhibitory effect on the growth of normal and malignant gastric mucosa cells and the inhibition become more evident with the increase of BMP-2 dose.
22323359 TMPRSS6, but not TF, TFR2 or BMP2 variants are associated with increased risk of iron-deficiency anemia in Chinese women.
22310349 Recombinant human bone morphogenetic protein-2 (rhBMP-2) is a successful adjunct for spinal fusion in pediatric patients.
22270235 The data indicated that BMP2 promoted the migration and invasion of MCF-7 cells by regulating the reorganization of cytoskeleton and the expression of adhesion molecules in/on the cells.
22119392 BMP-2 can inhibit LPS-induced TF protein expression and surface presentation in human MNCs by downregulation of Erk1/2, p38, and JNK signaling.
22102412 BMP2 induces osteoblast differentiation through Runx2-dependent ATF6 expression, which directly regulates Oc transcription.
21998741 BMP-2 had a similar binding affinity for each extracellular matrix, while TGF-beta1 had a greater affinity for ECMs produced by osteoblasts from control compared to craniosynostosis patients
21923031 The expressions of VEGF, bFGF, and BMP-2 mRNAs decline in traumatic and nontraumatic avascular necrosis of femoral head.
21907184 BMP-2-mediated NADPH oxidase activation increased ER stress leading to an increase in Runx2 expression thus promoting vascular smooth muscle cell calcification.
21885439 novel evidence that inhibition of BMP-2 or BMP-2-mediated MAPK/Runx2/Snail signaling is an attractive therapeutic target for osteolytic bone metastases in lung cancer patients.
21876344 The expression level of BMP2 is strongly elevated in kidney cancer
21842277 Mechanical loading upregulates BMP7, likely via the VDR, but not BMP2, gene and protein expression in osteocytes in vitro.
21777514 Runx2 plus BMP2 mediated efficient conversion of fibroblast-like ligamentum flavum cells into osteoblast- like cells.
21755409 after gamma-irradiation and transplantation, mesenchymal stem cells and rhBMP2 additively promoted and improved hematopoietic restoration and function
21720209 Our data suggest that miR-140 has a large number of targets conserved between human and chicken and we validate one of these, BMP2.
21702718 studies show that even though tenogenic (BMP 12 and BMP 13) and osteogenic (BMP2) BMPs bind the same receptors with high affinity they signal much differently and result in differential activation of osteogenic and tenogenic markers
21688537 relationship between serum level of bone morphogenetic proteins-2 (BMP-2) and heterotopic ossification (HO) in traumatic brain injury (TBI) and fractures patients
21688312 BMP-2 mediates PGE(2) -induced reduction of proliferation and osteogenic differentiation of tendon stem cells.
21688123 Bovine lactoferrin administration prevented the progression of hepatic failure in human myofibroblasts and mice, and enhanced IL-11 and BMP2 expression in the small intestine.
21673630 Tissue scaffold loaded with low-dose rhBMP-2 is comparable to autograft bone as a bone graft substitute in this large animal model of anterior lumbar body fusion.
21660578 To increase the osteogenic and angiogenic effects of marrow-derived mesenchymal stromal cells (MSCs), we co-transfected (by means of lentivirus) the human angiopoietin-1 gene (hAng-1) and human bone morphogenetic protein 2 gene (hBMP2) into MSCs.
21659661 ET-1 and BMP2 have opposing effects on chloride channel activity in human fibroblasts.
21655089 Multiple common susceptibility variants near BMP pathway loci GREM1, BMP4, and BMP2 explain part of the missing heritability of colorectal cancer
21570392 High BMP2 is associated with metastasis in gastric cancer.
21471203 Notch1 intracellular domain.RBPJk complex enhances the BMP2-induced Msx2 gene expression by cooperating with Smad1 and suggest that Notch signaling makes vascular SMC responsive to BMP2 and promotes vascular calcification.
21415150 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
21401418 All-trans retinoic acid and bone morphogenetic protein 2 synergistically induced alkaline phosphatase activity, one of the osteoblastic differentiation markers, and promoted extracellular matrix calcification in myoblastic C2C12 cell culture system.
21347550 pBMP-2 transfection mediated by GenEscorttrade mark II could enhance the osteogenic differentiation of canine bMSCs and promote the ectopic new bone formation in nude mice.
21327739 High serum BMP2 is associated with metastais in non-small-cell lung cancer.
21308777 An E3 ligase, neural precursor cell expressed, developmentally down-regulated 4 (Nedd4), also was found as one of the important modulators of the p-Smad1 in both BMP-2 and TGF-beta1 action.
21308375 The increase of BMP-2 appears as an effect of the electromagnetic field stimulations applied in orthopaedics.
21285872 expression lacks prognostic significance in uterine leiomyosarcomas
21277338 DNA methylation primes C2C12 cells for myogenesis and prevents spontaneous osteogenesis, but still permits induction of the osteogenic transcriptional program upon BMP2 stimulation.
21254281 In this large study of elderly patients who underwent lumbar fusion surgery, exposure to recombinant BMP2 was not associated with an increased risk of pancreatic cancer.
21247344 High doses of bone morphogenetic protein 2 induce structurally abnormal bone and inflammation in vivo.
21212630 BMP-2 requires Smad4 and the activation of the Par6/Smurf1 pathway
21205918 BMP2 expression is significantly increased in calcific aortic stenosis tissue compared to controls.
21128211 conclude that genetic variations in BMP-2 and -4 do not substantially contribute to lumbar spine bone mineral density in postmenopausal Turkish women
21121067 high glucose levels can evoke the calcification of human aortic smooth muscle cells by inducing osteoblastic trans-differentiation and intracellular calcium deposition via the BMP-2/Cbfalpha-1 pathway.
21096864 The objective of this work was to investigate the effect of sustained release of rhBMP-2, grafted to biodegradable nanoparticles (NPs) based on osteogenic differentiation of bone mesenchymal stem (BMS) cells.
21084396 Leiomyoma-secreted transforming growth factor beta 3 induces BMP-2 resistance in endometrium by down-regulation of bone morphogenetic protein receptor 2, likely causing defective endometrial decidualization
21054789 data indicate that WFIKKN proteins are antagonists of GDF8 and GDF11, but in the case of TGFbeta1, BMP2 and BMP4 they function as growth factor binding proteins
20939477 The mRNA expressions of VEGF and BMP-2 in the nontraumatic avascular necrosis of femoral head group were significantly lower than those in the control group.
20927405 The crystal structure of the complex of the BMPR-IA bound to the Fab AbD1556 revealed that the contact surface of BMPR-IA overlaps extensively with the contact surface for BMP-2 interaction.
20874259 TGF-beta1 enhances BMP-2-induced ectopic bone formation.
20848249 The data suggest that BMP-2 accelerates invasion of panc-1 cells via the PI3K/AKT pathway
20838369 Report few complications directly attributed to rhBMP-2/ACS in posterolateral spinal fusion.
20825377 study concludes that expression and disappearance of BMP-2 might contribute to folliculogenesis and luteinization by regulating gonadotropin receptor expression in granulosa cells
20818491 The results indicated that the combined delivery of bone marrow stem cells and BMP2 (group I) resulted in the highest regenerative effects on orbital bone defects, compared to the other groups without BMP2.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20730440 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20721706 Observational study of gene-disease association. (HuGE Navigator)
20684029 WISP-1 has a positive influence on bone cell differentiation and function and may work by enhancing the effects of BMP-2
20682677 Results indicate that bone morphogenetic proteins 2, 4, and7 may play a role in the process of spinal ankylosis.
20679527 Bone morphogenetic protein 2 is a major mediator of the hepcidin stimulatory activity of multiple myeloma sera.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20670444 BMP-2 seems to play an important role in surgically induced cartilage repair; synovial expression correlates with the clinical outcome.
20668165 These results indicate that PDZRN3 plays an important role in negative feedback control of BMP-2-induced osteoblast differentiation in C2C12 cells through inhibition of Wnt3a-beta-catenin signaling.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20651281 Expression of BMP-2, a potent initiator for osteoblast differentiation, was significantly enhanced in dedifferentiated vascular smooth muscle cells.
20637325 The present study was designed to clarify the effects of epinephrine on BMP-induced ectopic bone formation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20587070 Low BMP2 is associated with epithelial ovarian cancer.
20576608 Down-regulation of miR-208 in BMP-2-stimulated osteoblast differentiation is an important part of the regulatory machinery involved in early osteogenesis.
20567515 conclude that BMP-2/6 is more potent than BMP-2 or BMP-6 for inducing differentiation of human embryonic stem cells, and it can be used as a more powerful substitute of these BMPs in in vitro differentiation guidance
20565259 Borrelia burgdorferi CRASP-1 binds to several human extracellular matrix proteins and plasminogen that may contribute to adhesion, bacterial colonization, and organ tropism and may allow dissemination of Borrelia burgdorferi in the host.
20555025 The proteolytic activation and thus bioavailability of BMP2 is controlled by PC6.
20548225 BMSCs transfected with reconstructed plasmid pIRES-hBMP-2-VEGF165 could secret a high level of BMP-2 and hVEGF165.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20546278 Observational study of gene-disease association. (HuGE Navigator)
20537331 in chronic kidney disease, BMP-2 may represent the molecular link between oxidative stress and arterial stiffness due to vascular calcification
20530805 c/hemojuvelin is a broad spectrum bone morphogenetic protein (BMP) antagonist and inhibits both BMP2- and BMP6-mediated signaling and gene expression
20506112 Data find developmentally regulated and reciprocal patterns of expression of BMP2 and BMP4 and identify germ cells to be the exclusive targets of ovarian BMP signaling.
20505824 Agrin binds BMP2, BMP4 and TGFbeta1 with relatively high affinity.
20432444 Adiponectin enhances BMP-2 expression in osteoblastic cells, and AdipoR1 receptor, AMPK, p38 and NF-kappaB signaling pathways may be involved in increasing BMP-2 expression by adiponectin.
20432245 Elevated BMP2 synthesis is associated with increased malignancy in mouse models of lung cancer and poor lung cancer patient prognosis
20424473 Observational study of gene-disease association. (HuGE Navigator)
20348041 BMP2 plays an important role in the early stages of repair by recruiting local sources of skeletal progenitors within periosteum and endosteum.
20346918 elevated concentrations of Ca2+ increase the gene expression level of BMP-2 via an extracellular signal-regulated kinase (ERK) pathway and the influx of Ca2+ through voltage-gated calcium channels.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20304956 Epithelial to mesenchymal transition in human skin wound healing is induced by tumor necrosis factor-alpha through bone morphogenic protein-2
20302941 A novel procedure is presented which allows fast and efficient production of biologically active BMP-2.
20237276 BMP2 is both negatively and positively regulated by Smad4 and YY1 bound to a promoter region in cerebral cortex neurons.
20232298 Hypoxia enhances BMP-2 expression in osteoblasts by an HIF-1alpha-dependent mechanism involving the activation of ILK/Akt and mTOR pathways.
20065295 Neogenin regulates iron homeostasis via inhibiting secretion of HJV, an inhibitor of bone morphogenetic protein (BMP) signaling, to enhance BMP signaling and hepcidin expression.
20060812 GC-rich sequences within the BMP2 promoter region that strongly repress gene expression were identified.
20041271 The combination of recombinant human BMP-2 and allograft yields equivalent surgical outcomes as autograft in elderly patients undergoing instrumented posterolateral lumbar fusion.
20039267 Implicate STAT3 in the regulation of alkaline phosphatase expression by BMP-2 and dexamethasone in pluripotent stem cells.
20014079 Bone morphogenetic protein-responsive C2C12s to study the biological activity of collagen type I physisorbed BMP-2.
19953937 The expression of BMP-2 in chorioamniotic membranes is closely related to premature rupture of membranes.
19924575 High BMP2 is associated with gastric cancer progression.
19918795 Endoglin is involved in BMP-2-induced osteogenic differentiation of periodontal ligament cells through a pathway independent of Smad-1/5/8 phosphorylation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909214 These observations indicate that GDF-5 regulates differentiation of both dental papilla and follicle during odontogenesis, co-operatively with other growth factors such as BMP-2.
19879168 investigation of BMP2 as a potential modifier gene for HFE (i.e., modifying penetrance of p.C282Y homozygote): genetic association studies with a common SNP near BMP2 in hemochromatosis patients
19879168 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19857615 Overexpression of c-MYC particularly synergizes with endogenous BMP2 to enhance osteoblast differentiation and matrix maturation of human mesenchymal stem cells, and to a lesser extent enhances vitamin D-induced matrix mineralization.
19835871 BMP-2 promotes motility and invasion of gastric cancer cells by activating the PI-3 kinase/Akt signal pathway.
19811499 interactions between TNF-alpha, NF-kappaB, and BMP-2 may be pivotal not only in enhancing the osteomimicry and metastatic potential of prostatic cancer cells, but also in bone remodeling.
19800879 These results imply that M-Ras, induced and activated by BMP-2 signaling, participates in the osteoblastic determination, differentiation, and transdifferentiation under p38 MAPK and JNK regulation
19799789 BMP-2 and BMP-4 were equally effective in provoking chondrogenesis by primary human mesenchymal stem cells
19797419 BMP-2 is a highly sensitive marker for gliomas prognosis
19782107 the inhibition of apoptosis by BMP2 and GDF5 does not depend on more complex signal transduction pathways such as smad and MAPK signaling but on direct stabilization of XIAP by BMPR2.
19762079 The effects of rhBMP2 released from biodegradable polyurethane/microsphere composite scaffolds on new bone formation in rat femora are reported.
19754224 VEGF is a potent inhibitor of BMP2 expression in mesenchymal stem cells.
19713532 S100A4 and bone morphogenetic protein-2 codependently induce vascular smooth muscle cell migration via phospho-extracellular signal-regulated kinase and chloride intracellular channel 4.
19699244 Release characteristics and osteogenic activity of recombinant human bone morphogenetic protein-2 grafted to novel self-assembled poly(lactide-co-glycolide fumarate) nanoparticles.
19693635 Complications of recombinant human BMP-2 for treating complex tibial plateau fractures: a preliminary report.
19670606 BMP2 secreted by macrophages was important in formation of tympanosclerosis.
19655815 Studied BMP2-induced osteoblast transdifferentiation; 1321 potential phosphoproteins were identified; 374 BMP2-specific phosphoproteins and 54 up- or down-regulated proteins were selected. Thrombospondin1 was id'd as the highest up-regulated protein.
19653054 rhBMP-2 containing collagen sponges enhance bone repair in ovariectomized rats.
19639199 suppression of the PI3 kinase/Akt pathway is correlated with the development of BMP2 resistance and invasion in BMP2-induced EMT in colon cancer.
19609629 Report stimulation of ectopic bone formation in response to BMP-2 by Rho kinase inhibitor.
19584291 Quantitative PCR analysis revealed down-regulation of BMP2 and BMP5 in tissue samples from adrenocortical carcinoma and adrenocortical tumor cell lines compared with normal adrenal glands.
19582526 Successful spinal fusion by E. coli-derived BMP-2-adsorbed porous beta-tricalcium phosphate granules.
19492344 Individuals with the rs15705 SNP C/C genotype were associated with lower baseline subcutaneous fat volumes and an increased gain in skeletal muscle volume following resistance training in a cohort of young males.
19492344 Observational study of gene-disease association. (HuGE Navigator)
19473100 Findings demonstrate for the first time an endogenous survival pathway of hMSCs driven by a BMP signal.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19438813 analysis of the in vitro reconstruction of the mesenchymal condensation phenotype in the presence of BMP-2 in fetal serum-free cultures
19375587 Bone morphogenetic protein-2 activity is regulated by secreted phosphoprotein-24 kd.
19341710 BMP-2 down-regulates miR-206 expression at the post-transcriptional level, by inhibiting the processing of pri-miR-206 into mature miR-206, and that BMP-2 could regulate miRNA biogenesis by a novel mechanism.
19327734 additional functional mechanism for the pathogenesis of brachydactyly type A2, which is duplication of a regulatory element that affects the expression of BMP2 in the developing limb
19324883 ERRgamma is a novel negative regulator of osteoblast differentiation and bone formation via its regulation of Runx2 transactivity.
19324447 level of expression is associated with lung cancer
19301257 Osteoblastic bone formation is induced by using nanogel-crosslinking hydrogel as novel scaffold for BMP2.
19281856 The effects of shockwave on bone healing and systemic concentrations of BMP-2
19266077 Observational study of gene-disease association. (HuGE Navigator)
19240369 Osteoblasts exposed in dose-dependent manner to rhBMP-2, -4 and -7 had significantly lower rates of proliferation and higher rate of apoptosis.
19238726 The effects of BMP-2 on hBMSCs can vary depending on the stage of osteoblast differentiation.
19231972 Adipose tissue-derived mesenchymal stem cells differentially respond to BMP-2 and TGF-beta1 with changes in gene expression of collagen-modifying enzymes.
19140318 plays a crucial role in BMP-2 expression and acetylation of NF-kappaB p65 and p50 subunits by TSA treatment may activate the BMP-2 promoter.
19139264 The recruitment of both canonical and noncanonical Wnt pathways is required in BMP-2-mediated angiogenesis.
19123988 findings show that BMP-2 expression is sufficient for initiating breast cancer microcalcification in a rodent model
19113914 PKA signaling synergizes with SOX9 at the nuclear and cytoplasmic levels to promote BMP-2-induced osteochondrogenic differentiation.
19112539 BMP-2-containing poly(L-lactic acid) nanofibers affect growth and osteogenic differentiation of human mesenchymal stem cells
19098993 Human sclera fibroblasts expressed BMP-2, which promoted cell proliferation, and elicited changes in MMP-2 and TIMP-2, might influence extracellular matrix synthesis.
19080362 Chinese Han male patients with TC and CC genotypes in exon 3 (-726) T/C have genetic susceptibility to OPLL but not to more extensive OPLL in the cervical spine.
19080362 Observational study of gene-disease association. (HuGE Navigator)
19058174 There was a significant reduction in BMP-2 and BMP-14 expression in cartilaginous areas of nonhealing fractures compared to healing fractures
19038372 BMP-2 enhanced the invasiveness of chondrosarcoma cells by increasing MMP-13 expression through the PI3K, Akt, c-Fos/c-Jun and AP-1 signal transduction pathway.
19023570 BMP-2 and BMP-14 expression was strongest in areas of cartilage formation and, to a lesser extent, in areas of bone formation.
19018606 In a clinical setting with a high risk of infection and nonunion, such as a compound fracture with bone loss, rhBMP-2 may increase the rate and extent of bone formation.
18950289 BMP-2 enhances TGF-beta3-mediated chondrogenesis of mesenchymal stromal cells.
18937504 The solution structure of BMPR-IA reveals a local disorder-to-order transition upon BMP-2 binding.(
18818419 BMP2/4 were selectively expressed by endothelial colony-forming cells but not by early colonies in culture (CFU-Hill).
18812404 Our findings demonstrate a novel genomic disorder characterised by deletion of BMP2 with variable cognitive deficits and dysmorphic features and show that individuals bearing microdeletions in 20p12.3 often present with Wolff-Parkinson-White syndrome.
18773965 Our study has provided evidence that BMPR-IB-dependent signaling plays a crucial role in BMP-2 up-regulation of the ALP, OC, Dlx5 and Cbfa1 genes in bone cells, suggesting a role of this receptor in BMP-2-induced osteoblast differentiation in vitro.
18720410 These results suggest that the BMP-2 acts through PI3K/Akt, which in turn activates IKKalpha/beta and NF-kappaB, resulting in the activations of beta1 integrin and contributing the migration of human chondrosarcoma cells.
18720162 BMP2 stimulates chondrogenic expression in human nasal chondrocytes expanded in vitro.
18703506 analysis of cis-regulatory elements that control a species-specific difference in the 3'-end processing of BMP2 and potentially of other genes
18600473 TGF-beta1 or activin A but not BMP-2 significantly decreased significantly decreased melanin content and expression of Tyrosinase and Tyrp-1 in the absence of alpha-MSH in melanoma cells
18586671 TSG-6 has dual roles in bone remodeling: it inhibits RANKL-induced bone erosion in inflammatory diseases, and its interactions with BMP-2 and RANKL help to balance mineralization by osteoblasts and bone resorption by osteoclasts
18546152 Proteomic profiling of CHO cells with enhanced rhBMP2 productivity following co-expression of furin is reported.
18512729 Osteoblast-derived BMP-2 act through Akt and ERK, which in turn activates IKK alpha/beta and NF-kappaB, resulting in the activations of beta1 and beta 3 integrins and contributing the migration of prostate cancer cells.
18510873 The developed synthetic gene is a promising approach for scaling-up the soluble expression of hBMP-2.
18490653 activation of protein kinase A elicits an immediate response through induction of genes such as ID2 and FosB, followed by sustained secretion of bone-related cytokines such as BMP-2, IGF-1, and IL-11
18471510 In MSI CRC this is associated predominantly with impaired BMPR2 expression and in MSS CRC with impaired SMAD4 expression.
18465455 Overproduction of BMP-2 was noted in ankylosing spondylitits patients but there was an absence of a correlation between BMP-2 and changes in noted in the spine
18436533 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells
18434375 BMP2 and TGFbeta1 are likely to be involved in HESC decidualization
18426824 alleles exerting a beneficial effect in young women may subsequently contribute to phenotypes associated with osteoporosis risk in elderly women
18426824 Observational study of gene-disease association. (HuGE Navigator)
18404105 BMP-2-producing human adipose tissue-derived mesenchymal stem cells, created using adenoviral gene transfer, induced spinal fusion in athymic rats.
18400943 These results support a model in which the angular gradient in gap junction-mediated intercellular coupling in the lens, and thus proper lens function, is dependent on signaling between the FGF and BMP pathways.
18389292 BMP-2 Gene is not only a factor associated with the occurrence ofossification of the posterior longitudinal ligament (OPLL), but also a factor related to more extensive OPLL
18389292 Observational study of gene-disease association. (HuGE Navigator)
18382765 Results describe an antiproliferative BMP-2/PPARgamma/apoE axis in human and murine SMCs and its role in pulmonary hypertension.
18326817 BMP-2, BMP-4, and BMP-6 are endogenous ligands for Hemojuvelin in hepatoma-derived cell lines, and all 3 of these ligands are expressed in human liver
18311072 findings indicate that BMP-2 expression induced by high glucose might be closely related to NF-kappaB activation.
18287331 results show that different isoforms of hemojuvlin may play unique physiological roles through defined interactions with distinct signaling proteins such as BMP2 and neogenin, and demonstrate that some of these interactions are defective.
18179800 BMP-2 may promote vascular calcification via increased phosphate uptake and induction of osteogenic phenotype modulation in SMC
18160401 inactivating BMPR-IA and causing a loss of the BMP-2 tumor suppressor function in colon epithelial cells.
18160010 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Tat induces significantly higher secretion of BMP-2 and BMP-7 ligands when compared with that of untreated cells
18156628 HtrA1 may regulate matrix calcification via the inhibition of BMP-2 signaling, modulating osteoblast gene expression, and/or via the degradation of specific matrix proteins
18059158 BMP2 downregulates PTEN via RAS/ERK in a SMAD4-null environment that contributes to cell growth, and constitutes a SMAD4-independent but BMP-responsive signaling pathway.
18059017 post-transcriptional mechanisms including regulation of RNA stability, rather than transcriptional mechanisms, contributed to the increased BMP2 expression in mycoplasma-infected cells.
18029192 BMP-7 but not BMP-2 and BMP-4 prevents the loss of primitive hematopoietic progenitor cells cultured in SFM plus SF3.
18021008 polymorphisms in the BMP2 and BMP4 genes, both members of the TGF-beta superfamily, contribute to the susceptibility to otosclerosis and further strengthen the results from the recently reported association of TGFB1 with this disease
17997109 Members of the transforming growth factor beta (TGFbeta) superfamily, bone morphogenetic protein 2 (BMP2), and growth and differentiation factor 11 (GDF11), can signal cultured RGCs to form dendrites
17960657 Cotransfection of mesenchymal stem cells with the combination of the CTLA4Ig and the BMP2 gene stimulates osteoblastic cell differentiation in vitro.
17919499 Statins induce apoptosis in colorectal tumor cells through induction of BMP2. Statin therapy may only be effective in SMAD4-expressing tumors and may have adverse effects in SMAD4-negative tumors.
17847004 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17847004 interactive effect on serum ferritin level of rs235756 in BMP2 and a SNP in HJV, with a small additive effect of a SNP in BMP4
17824831 STRO-1 selected rat dental pulp stem cells transfected with adenoviral-mediated human BMP2 gene show enhanced odontogenic differentiation.
17726567 Observational study of gene-disease association. (HuGE Navigator)
17726567 Variation in BMP2 masy play a previously unidentified role in aspects of bone density, which may be age- and site-dependent.
17711857 BMP2 functions via a conserved signaling pathway involving Wnt4 to regulate uterine decidualization.
17681894 PKA signaling pathway would be the main intracellular signaling pathway of the EP4 for the anabolic effect of bone and mineral metabolisms
17656261 Approximately half of the prostate tumors displayed increased copy numbers of the BMP2, BMP5, BMP7, and UC28 gene loci, which may account for their abnormal gene expression patterns in neoplastic prostate tissue.
17617489 Glycidyl methacrylated dextran gelatin scaffolds containing micospheres loaded with BMP2 enhanced periodontal regeneration.
17608624 Plasmid gene BMP-2 delivery induces bone marrow stromal cells into osteoblastic phenotype cells and enhances bone regeneration in rabbit calvarial bone defects.
17577985 Data show that pcDNA-BMP2/6 produced more rhBMP6 than pcDNA-BMP6.
17553463 lysyl hydroxylases and lysyl oxidase/lysyl oxidase-like proteins are differentially responsive to BMP-induced osteoblast differentiation
17549388 BMP2 regulates the interaction of IGF-1 with growth plate chondrocytes.
17530715 BMP-2 induced the chondrogenic differentiation of synovial explants in a dose- and time-dependent manner under serum- and dexamethasone-free conditions
17519894 BMP2 augmentation might be critically important in achieving this effect
17518682 Increased mRNA expression of BMP-2 in bone marrow derived cultured human mesenchymal stem cells under cyclic tensile strain demonstrates the critical nature of mechanical factors in the osteogenic differentiation process.
17504062 We conclude that the controlled release of BMP-2 for a certain time period was essential to inducing the osteoinductive potential of BMP-2.
17472960 RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and that increased utilization of ActRIIA leads to generation of an enhanced BMP signal
17437303 Results show that cells contacting 316L steel are exposed to increased concentrations of Ni which suffice to impair BMP-2-induced ALP activity.
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
17401695 BMP-2, TGF-beta2, and TGF-beta3 are involved in bone formation in heterotopic ossifications.
17262821 strong BMP staining is seen in maturing chondrocytes, and thus may play a role in chondrocyte differentiation and/or apoptosis; BMP release by osteoclasts may promote osteoblastic differentiation at sites of bone remodeling
17255107 the BMP1 prodomain specifically binds and regulates signaling by BMP2 and BMP4
17168321 rhBMP-2 could significantly increase the ALP activity of C2C12.
17138967 Results show calcium-sensing receptor regulate BMP-2 synthesis and secretion required phosphatidylinositol 3-kinase activation.
17120779 Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation
17003113 GREMLIN 1 was expressed in the stroma of human basal cell carcinoma (BCC) tumors but not in normal skin in vivo. Bone morphogenetic protein (BMP) 2 and 4 are expressed by BCC cells.
16893455 Bone morphogenetic protein 2 (BMP-2) mRNA was upregulated in injured articular cartilage explants
16835229 TNF-alpha increases the stability of BMP-2 mRNA through the pentameric motifs via NF-kappaB
16815889 BMP-2 significantly (>2-fold) upregulated mRNA expression of KCNA5, KCNA7, KCNA10, KCNC3, KCNC4, KCNF1, KCNG3, KCNS1, and KCNS3 but downregulated (at least 2-fold) KCNAB1, KCNA2, KCNG2, and KCNV2 in pulmonary artery smooth muscle
16771708 TSG-6 is down-regulated during osteoblastic differentiation, and suppressed osteoblastic differentiation induced by both BMP-2 and osteogenic differentiation medium.
16754660 heparin enhances BMP-2-induced osteoblast differentiation in vitro and in vivo by protecting BMPs from degradation and inhibition by BMP antagonists
16753015 Observational study of gene-disease association. (HuGE Navigator)
16719933 Topical and differential expression of BMP-2/4 and BMP-7 mRNA and protein was found in bursa tissue.
16672363 structure of the ternary complex representing the signaling competent complex of BMP-2 bound to the entire extracellular domains of both its type I receptor, BMPR-Ia, & its type II receptor, ActRII, at a resolution of 2.2 angstroms
16637042 Potential use of slow degrading silk fibroin 3-D scaffolds loaded with BMP-2 in combination with human bone marrow cells to induce osteogenesis.
16621789 BMP-2 antagonizes Wnt-3a signaling in osteoblast progenitors by promoting an interaction between Smad1 and Dvl-1 that restricts beta-catenin activation
16615932 Finally, two inhibitors of cyclin-dependent kinase 9 (a dominant negative CDK9 and flavopiridol) repressed activity from the MR and BMPR2 promoters
16613856 BMP-2 stimulates Runx2 acetylation
16604289 Observational study of gene-disease association. (HuGE Navigator)
16598384 autocrine BMP production is necessary for the RUNX2 transcription factor to be active and that BMPs and RUNX2 cooperatively interact to stimulate osteoblast gene expression.
16453284 Observational study of gene-disease association. (HuGE Navigator)
16442268 Bone morphogenetic protein-2 modulates Wnt and frizzled expression and enhances the canonical pathway of Wnt signaling in normal keratinocytes
16432645 Observational study of gene-disease association. (HuGE Navigator)
16391828 identified several BMP-2-responsive genes in LNCaP cells, human prostate cancer cell line
16326713 Data show that phosphophoryn (PP) up-regulates bone morphogenetic protein 2 gene expression 12 h post-treatment with PP, much later than initial detection of Smad1 phosphorylation at 30 min.
16261446 data indicate that BMP-2 can utilize a new signal transduction pathway in the NF-kappaB activation system, which plays a crucial role in the survival of the N1511 chondrocytic cell line
16247476 Forced expression of BMP-2 in A549 cells significantly enhanced tumor growth in the lungs following intravenous injection but not of subcutaneous tumors
16157126 The principal finding of this study was that BMP2 is up-regulated in the chorioamniotic membranes in labor and histologic chorioamnionitis.
16150699 findings identify functional cross-talk of Id1 expression between Wnt and BMP signaling and demonstrate a novel mechanism for Wnt regulation of the BMP-2 response, linking Id1 expression to Wnt/beta-catenin signaling
16126463 BMPs influence the formation of the osteolytic prostate cancer metastases, and treatment modalities that inhibit BMP activity may limit the progression of the lytic component of prostate cancer metastases.
16000303 Osterix regulation by recombinant BMP-2 proceeds via protein kinase D and MAP kinase (p38 and JNK) signaling in human mesenchymal stem cells
15861517 To analyze the expression of bone morphogenetic proteins (BMPs) in prostate and breast cancers with established metastasis in bone
15857508 Treatment of pulmonary arterial smooth muscle cells with HIV-1 Tat induces significantly higher secretion of BMP-2 and BMP-7 ligands when compared with that of untreated cells
15851600 (TNF)-alpha induced NF-kappaBeta activation and elicited significant increases in BMP-2 mRNA and protein in human umbilical vein endothelial cells
15647840 BMP-2 inhibits DHT-induced growth of LNCaP cells through a decrease in E2F protein expression and suppression of E2F activity by hypophosphorylation of Rb
15647827 BMP-2 upregulates the expression of alphavbeta integrins, and these integrins, in turn, play a critical role in BMP-2 function in osteoblasts
15641068 In the presence of 10 microg rHuBMP-2, muscle-derived mesenchymal cells expressed type II collagen messenger RNA at 4 days after transplantation, and a mature cartilage mass was formed 5 weeks after transplantation in the diffusion chamber.
15592496 The expression of tenascin-W is induced by BMP-2 in mammary canacer.
15358784 The Bmp2 3' UTR contains essential regulatory elements that act post-transcriptionally
15322112 Myogenin protein stability is decreased by BMP-2 through a mechanism implicating Id1.
15240857 Observational study of gene-disease association. (HuGE Navigator)
15150273 bone morphogenetic protein 2- and transforming growth factor beta-regulated osteoblastic differentiation requires menin, Smads and Runx2
15102076 BMP2 or 4 in pilomatricoma is responsible for induction of proalpha(1)(II) collagen mRNA in overlying epidermal cells resulting in deposition of type II collagen in dermo-epidermal junction.
15042598 Decreased BMP2 expression associated with progression to prostate cancer; loss of BMP2 and Smad4 related to progression to a more aggressive phenotype
15037653 BMP-2 enhanced the angiogenic response in developing tumors
14699493 BMP2 acts as a tumor suppressor promoting apoptosis in mature colonic epithelial cells.
14691541 a region on the short arm of Chromosome 20 contains a gene or genes that appear to be a major risk factor for osteoporosis and osteoporotic fractures, including BMP2
14587031 the effect of MGP on calcification and osteogenic differentiation is determined by availability of BMP-2
14558086 BMP-2 and BMP-6 are expressed in arthritic synovium and are strongly up-regulated by proinflammatory cytokines.
14499589 These results indicate that the 73-92 peptide of bone morphogenetic protein-2 (BMP-2) may be a receptor-binding site and may stimulate bone precursor cells to induce calcification.
13678785 BMP-2 stimulated Placental growth factor secretion from MG63 osteosarcoma and mesenchymal stem cells
12933820 brief exposure to recombinant human bone morphogenetic protein-2 (rhBMP-2)is sufficient to induce irreversible commitment to mineralization in dexamethasone-treated osteoblast cultures
12925611 In cell culture, IL-1beta and TNF-alpha increased BMP-2 mRNA and protein levels by eightfold and fifteenfold, respectively, whereas IGF-1 and TGF-beta1 had no effect. In cartilage explant cultures, IL-1beta and TNF-alpha increased BMP-2 levels.
12919699 Study evaluates several aspects of the osteogenic effect of human BMP-2 protein injected into quadriceps of female C57B1/6J SCID mice.
12872164 Data show that retinoid-induced expression of bone morphogenetic protein-2 is necessary and sufficient for apoptosis of retinoid-responsive cells.
12856332 Results suggest that rHuIL-11 acts synergistically with rHuBMP-2 to more rapidly stimulate bone formation compared with rHuBMP-2 alone.
12854828 BMP-2 exerts both positive and negative effects on osteoblasts, possibly depending on the differentiation stage and/or the existing BMP signaling
12819188 expression of the mature BMP-2 protein is disregulated in the majority of NSCLC. BMP-2 enhancement of tumor cell migration and invasion, as well as stimulating tumor growth in vivo, suggests it has important biological activity in lung carcinomas.
12740218 In pulmonary artery smooth muscle cells from pulmonary hypertension patients, the BMP-2- or BMP-7-induced apoptosis was significantly inhibited compared with PASMCs from patients with secondary pulmonary hypertension.
12620973 BMP2 exposure can regulate PTEN protein levels by decreasing PTEN's association with the degradative pathway
12535648 results show that expression of a dominant negative type II TGFbeta receptor impairs BMP2 signaling in MDA-MB-231 breast cancer cells, resulting in an attenuation of the anti-proliferative effects of BMP2 on these cells
12531697 BMP2 and BMP4 differently affect activin A induction of erythropoiesis; follistatin and FLRG proteins downmodulate the effects of activin A and BMP2.
12527559 BMP-2 inhibits PDGF-stimulated proliferation of HASMCs through induction of p21. p21-mediated induction of cell cycle arrest by BMP-2 may initiate osteogenic differentiation of vascular smooth muscle cells, ultimately leading to vascular mineralization.
12489168 BMP2 can recruit progenitors to the cementoblastic lineage and regulate differentiation by inducing and enhancing the expression of cementum attachment protein, a cell lineage-specific regulator.
12210753 rhBMP-2 promotes MSC activity and reverses bone and cartilage loss in osteopenic mice
12168799 BMP2 has a role in controlling normal and premature cranial ossification in humans [review]
12126644 BMP2 binds to collagen II at a specific binding domain and has a role in embryo development, organogenesis, and regeneration of damaged tissues
12082094 induces osteocalcin expression in osteoblasts
12052447 Local application of recombinant human BMP2 from coated titanium implants significantly improves fracture healing, biomechanical torsional stability, and callus remodeling in a rat model.
12002771 REVIEW:Bone morphogenetic protein (BMP)-2 cell cycle arrest and apoptosis in human myeloma cells.
11968014 RT-PCR analysis of human bone marrow stromal cells during osteogenesis in vitro: the mRNA levels of bone morphogenetic protein-2 (BMP-2), bone sialoprotein-II (BSP), osteopontin (OP) and cbfa-1 increased with culture time in osteogenic medium.
11854297 BMP-2 and TGF-beta activate both Ras/MAPK/AP-1 and Smad signaling in osteoblasts with Smads modulating AP-1 activity.
11792561 Macrophage cell lines produce osteoinductive signals that include bone morphogenetic protein-2.
11748585 promotes chondrogenic differentiation of multipotential mesenchymal cells
11718007 BMP-2 gene transfection tends to accelerate HPDLFs into osteoblast-like cells.
11642720 The expression signals of BMP-2 mRNA in malignant schwannoma were not lower than in benign lesions

AA Sequence

MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPS      1 - 70
RDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIP     71 - 140
TEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVT    141 - 210
PAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKRE    211 - 280
KRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN    281 - 350
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR                            351 - 396
//

Text Mined References (504)

PMID Year Title
26845276 2016 Genome-wide environment interaction between depressive state and stressful life events.
26808122 2016 Adenoviral Mediated Expression of BMP2 by Bone Marrow Stromal Cells Cultured in 3D Copolymer Scaffolds Enhances Bone Formation.
26636769 2015 Upregulation of Bone Morphogenetic Protein-2 Synthesis and Consequent Collagen II Expression in Leptin-stimulated Human Chondrocytes.
26621735 2015 Identifying an ovarian cancer cell hierarchy regulated by bone morphogenetic protein 2.
26563344 2015 Activin A/BMP2 chimera AB235 drives efficient redifferentiation of long term cultured autologous chondrocytes.
26494778 2015 Bone Morphogenetic Protein-2 Induces Donor-Dependent Osteogenic and Adipogenic Differentiation in Human Adipose Stem Cells.
26491693 2015 Repair of Cranial Bone Defects Using rhBMP2 and Submicron Particle of Biphasic Calcium Phosphate Ceramics with Through-Hole.
26466853 2015 Effects of heterodimeric bone morphogenetic protein-2/7 on osteogenesis of human adipose-derived stem cells.
26460254 2015 A coding polymorphism in the BMP2 gene is associated with iron overload in non-HFE haemochromatosis patients.
26413886 2016 Imbalance Between Bone Morphogenetic Protein 2 and Noggin Induces Abnormal Osteogenic Differentiation of Mesenchymal Stem Cells in Ankylosing Spondylitis.
26400336 2015 Bone morphogenetic protein 2 and decorin expression in old fracture fragments and surrounding tissues.
26308798 2016 Inflammatory Cytokines Stimulate Bone Morphogenetic Protein-2 Expression and Release from Pancreatic Beta Cells.
26292283 2015 Human Articular Cartilage Progenitor Cells Are Responsive to Mechanical Stimulation and Adenoviral-Mediated Overexpression of Bone-Morphogenetic Protein 2.
26124007 2015 BMP-2 induces motility and invasiveness by promoting colon cancer stemness through STAT3 activation.
26047580 2015 Bone morphogenetic protein 2-induced human dental pulp cell differentiation involves p38 mitogen-activated protein kinase-activated canonical WNT pathway.
26003174 2015 Increased plasma BMP-2 levels are associated with atherosclerosis burden and coronary calcification in type 2 diabetic patients.
25996180 2015 Effects of Ovariectomy and Corticosteroid-Induced Osteoporosis on the Osteoinductivity of rhBMP-2 in a Segmental Long-Bone Defect Model.
25976471 2015 Hereditary hemochromatosis type 1 phenotype modifiers in Italian patients. The controversial role of variants in HAMP, BMP2, FTL and SLC40A1 genes.
25938661 2015 Repulsive guidance molecule is a structural bridge between neogenin and bone morphogenetic protein.
25924783 2015 BMP2 response pattern in human lung fibroblasts predicts outcome in lung adenocarcinomas.
25920311 2015 [Polymorphism of bone morphogenetic protein (BMP2) and osteoporosis etiology].
25917422 2015 Hydrogel-based Delivery of rhBMP-2 Improves Healing of Large Bone Defects Compared With Autograft.
25837159 2015 Estrogen Modulates Bone Morphogenetic Protein-Induced Sclerostin Expression Through the Wnt Signaling Pathway.
25817394 2015 Long-term controlled delivery of rhBMP-2 from collagen-hydroxyapatite scaffolds for superior bone tissue regeneration.
25814267 2015 hBMP-2 and hTGF-?1 expressed in implanted BMSCs synergistically promote the repairing of segmental bone defects.
25797254 2015 Inactivation of bone morphogenetic protein 2 may predict clinical outcome and poor overall survival for renal cell carcinoma through epigenetic pathways.
25776852 2015 Turning Bone Morphogenetic Protein 2 (BMP2) on and off in Mesenchymal Cells.
25705677 2015 Application of AMOR in craniofacial rabbit bone bioengineering.
25698539 2015 C23 protein meditates bone morphogenetic protein-2-mediated EMT via up-regulation of Erk1/2 and Akt in gastric cancer.
25681461 2015 Moderate alterations of the cytoskeleton in human chondrocytes after short-term microgravity produced by parabolic flight maneuvers could be prevented by up-regulation of BMP-2 and SOX-9.
25668064 2015 Nanoscale control of surface immobilized BMP-2: toward a quantitative assessment of BMP-mediated signaling events.
25656933 2015 Extracellular Ca2+ Promotes Odontoblastic Differentiation of Dental Pulp Stem Cells via BMP2-Mediated Smad1/5/8 and Erk1/2 Pathways.
25644704 2015 Correlation of bone morphogenetic protein-2 levels in serum and synovial fluid with disease severity of knee osteoarthritis.
25640452 2015 Osteoporosis-associated alteration in the signalling status of BMP-2 in human MSCs under adipogenic conditions.
25601208 2015 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response.
25562153 2014 Vascular calcification in chronic kidney disease is induced by bone morphogenetic protein-2 via a mechanism involving the Wnt/?-catenin pathway.
25448881 2015 Bone morphogenetic protein 2 mediates epithelial-mesenchymal transition via AKT and ERK signaling pathways in gastric cancer.
25431339 2015 BMP-2 inhibits tumor-initiating ability in human renal cancer stem cells and induces bone formation.
25430711 2014 Effects of cartilage oligomeric matrix protein on bone morphogenetic protein-2-induced differentiation of mesenchymal stem cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25412776 2015 BMP-2 and TGF-?1 mediate biglycan-induced pro-osteogenic reprogramming in aortic valve interstitial cells.
25391427 2015 Associations of polymorphisms in the bone morphogenetic protein-2 gene with risk and prognosis of osteosarcoma in a Chinese population.
25378054 2015 Gremlin1 preferentially binds to bone morphogenetic protein-2 (BMP-2) and BMP-4 over BMP-7.
25359431 2015 Oxytalan-positive peripheral ossifying fibromas express runt-related transcription factor 2, bone morphogenetic protein-2, and cementum attachment protein. An immunohistochemical study.
25350918 2015 Proprotein convertase 5/6a is associated with bone morphogenetic protein-2-induced squamous cell differentiation.
25329960 2014 COMP-angiopoietin1 potentiates the effects of bone morphogenic protein-2 on ischemic necrosis of the femoral head in rats.
25301360 2014 BMP2 increases adipogenic differentiation in the presence of dexamethasone, which is inhibited by the treatment of TNF-? in human adipose tissue-derived stromal cells.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25191703 2014 Uniaxial cyclic stretch promotes osteogenic differentiation and synthesis of BMP2 in the C3H10T1/2 cells with BMP2 gene variant of rs2273073 (T/G).
25152406 2014 Mesenchymal stem cells from osteoporotic patients reveal reduced migration and invasion upon stimulation with BMP-2 or BMP-7.
25099618 2014 The correlation of bone morphogenetic protein 2 with poor prognosis in glioma patients.
25099263 2014 Vancomycin-bearing synthetic bone graft delivers rhBMP-2 and promotes healing of critical rat femoral segmental defects.
25070743 2014 Proliferation and odontogenic differentiation of BMP2 gene?transfected stem cells from human tooth apical papilla: an in vitro study.
25027287 2014 Temporal regulation of mRNAs for select bone morphogenetic proteins (BMP), BMP receptors and their associated SMAD proteins during bovine early embryonic development: effects of exogenous BMP2 on embryo developmental progression.
24954001 2014 Oxidized alginate hydrogels for bone morphogenetic protein-2 delivery in long bone defects.
24946687 2014 Silencing BMP-2 expression inhibits A549 and H460 cell proliferation and migration.
24942379 2014 Effective immobilization of BMP-2 mediated by polydopamine coating on biodegradable nanofibers for enhanced in vivo bone formation.
24928442 2014 miR-140-5p suppresses BMP2-mediated osteogenesis in undifferentiated human mesenchymal stem cells.
24885555 2014 BMP2-induced chemotaxis requires PI3K p55?/p110?-dependent phosphatidylinositol (3,4,5)-triphosphate production and LL5? recruitment at the cytocortex.
24828823 2014 Selective small molecule compounds increase BMP-2 responsiveness by inhibiting Smurf1-mediated Smad1/5 degradation.
24814649 2014 BMP-2 and -4 produced by vascular smooth muscle cells from atherosclerotic lesions induce monocyte chemotaxis through direct BMPRII activation.
24804200 2014 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24783213 2014 Effect of different rhBMP-2 and TG-VEGF ratios on the formation of heterotopic bone and neovessels.
24764222 2015 Synergistic induction of early stage of bone formation by combination of recombinant human bone morphogenetic protein-2 and epidermal growth factor.
24764177 2015 Controlled release of BMP-2 using a heparin-conjugated carrier system reduces in vivo adipose tissue formation.
24743742 2014 Opposing TNF-?/IL-1?- and BMP-2-activated MAPK signaling pathways converge on Runx2 to regulate BMP-2-induced osteoblastic differentiation.
24742993 2014 Involvement and alteration of the Sonic Hedgehog pathway is associated with decreased cholesterol level in trisomy 18 and SLO amniocytes.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24737472 2014 Association between BMP-2 and COL6A1 gene polymorphisms with susceptibility to ossification of the posterior longitudinal ligament of the cervical spine in Korean patients and family members.
24723453 2014 Coleusin factor, a novel anticancer diterpenoid, inhibits osteosarcoma growth by inducing bone morphogenetic protein-2-dependent differentiation.
24710560 2014 Identification of duplication downstream of BMP2 in a Chinese family with brachydactyly type A2 (BDA2).
24682653 2014 Canonical BMP-Smad signalling promotes neurite growth in rat midbrain dopaminergic neurons.
24643989 2014 Relaxin augments BMP-2-induced osteoblast differentiation and bone formation.
24639043 2015 Optimization of release pattern of FGF-2 and BMP-2 for osteogenic differentiation of low-population density hMSCs.
24601881 2014 Bone morphogenetic protein 2 stimulates noncanonical SMAD2/3 signaling via the BMP type 1A receptor in gonadotrope-like cells: implications for FSH synthesis.
24585058 2014 Identification of BMP2 as an epigenetically silenced growth inhibitor in rhabdomyosarcoma.
24573607 2014 Bone morphogenetic protein 2 inhibits hepatocellular carcinoma growth and migration through downregulation of the PI3K/AKT pathway.
24561081 2014 Cyclic tensile force up-regulates BMP-2 expression through MAP kinase and COX-2/PGE2 signaling pathways in human periodontal ligament cells.
24551273 2014 Expression analysis of BMP2, BMP5, BMP10 in human colon tissues from Hirschsprung disease patients.
24551211 2014 Sox9 potentiates BMP2-induced chondrogenic differentiation and inhibits BMP2-induced osteogenic differentiation.
24492129 2014 Rare variants in BMP2 and BMP4 found in otosclerosis patients reduce Smad signaling.
24477555 2014 Bmp 2 and bmp 7 induce odonto- and osteogenesis of human tooth germ stem cells.
24477081 2014 Does recombinant human bone morphogenetic protein-2 use in adult spinal deformity increase complications and are complications associated with location of rhBMP-2 use? A prospective, multicenter study of 279 consecutive patients.
24409810 2014 JNK MAPK is involved in BMP-2-induced odontoblastic differentiation of human dental pulp cells.
24406215 2014 Promotion of dentin regeneration via CCN3 modulation on Notch and BMP signaling pathways.
24393182 2013 Use of bone morphogenetic protein-2 (rh-BMP-2) in treatment of wrist and hand nonunion with comparison to historical control groups.
24387671 2014 Does the calcification of adamantinomatous craniopharyngioma resemble the calcium deposition of osteogenesis/odontogenesis?
24362451 2014 Involvement of the osteoinductive factors, Tmem119 and BMP-2, and the ER stress response PERK-eIF2?-ATF4 pathway in the commitment of myoblastic into osteoblastic cells.
24339730 2013 Genistein promotion of osteogenic differentiation through BMP2/SMAD5/RUNX2 signaling.
24321094 2014 NOTCH1 signaling regulates the BMP2/DLX-3 directed osteogenic differentiation of dental follicle cells.
24288199 2014 Inhibition of rhBMP-2-induced ALP activity by intracellular delivery of SMURF1 in murine calvarial preosteoblast cells.
24269858 2014 Nerve injury and recovery after lateral lumbar interbody fusion with and without bone morphogenetic protein-2 augmentation: a cohort-controlled study.
24266740 2014 In situ controlled release of rhBMP-2 in gelatin-coated 3D porous poly(?-caprolactone) scaffolds for homogeneous bone tissue formation.
24247005 2014 BMP-2 expression correlates with local failure in head and neck squamous cell carcinoma.
24205156 2013 Heterodimeric BMP-2/7 antagonizes the inhibition of all-trans retinoic acid and promotes the osteoblastogenesis.
24175816 2013 Serum BMP-2 up-regulation as an indicator of poor survival in advanced non-small cell lung cancer patients.
24153173 2014 Effectiveness and safety of recombinant human bone morphogenetic protein-2 versus local bone graft in primary lumbar interbody fusions.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
24100446 2013 Primitive CML cell expansion relies on abnormal levels of BMPs provided by the niche and on BMPRIb overexpression.
24077220 2013 Role of matrix metalloproteinase-10 in the BMP-2 inducing osteoblastic differentiation.
24060635 2014 Crosstalk between tyrosine kinase receptors, GSK3 and BMP2 signaling during osteoblastic differentiation of human mesenchymal stem cells.
23977328 2013 Sustained release of BMP-2 in bioprinted alginate for osteogenicity in mice and rats.
23977305 2013 Enhanced osteogenesis of adipose derived stem cells with Noggin suppression and delivery of BMP-2.
23918166 2013 Fluoride promotes viability and differentiation of osteoblast-like Saos-2 cells via BMP/Smads signaling pathway.
23916851 2013 SDF-1?/CXCR4 signaling mediates digit tip regeneration promoted by BMP-2.
23901942 2013 Bone morphogenetic protein-2 plasmid DNA as a substitute for bone morphogenetic protein-2 protein in bone tissue engineering.
23900689 2013 Bone formation induced by BMP-2 in human osteosarcoma cells.
23853066 2014 Bone morphogenetic protein-2, -6, and -7 differently regulate osteogenic differentiation of human periodontal ligament stem cells.
23825642 2013 Characteristics and stimulation potential with BMP-2 and BMP-7 of tenocyte-like cells isolated from the rotator cuff of female donors.
23790163 2013 Osteogenic potential of BMP-2-releasing self-assembled membranes.
23784946 2016 Mineralization of three-dimensional osteoblast cultures is enhanced by the interaction of 1?,25-dihydroxyvitamin D3 and BMP2 via two specific vitamin D receptors.
23716395 2013 Inhibition of BMP activity protects epithelial barrier function in lung injury.
23708553 2013 Calcitonin gene-related peptide stimulates BMP-2 expression and the differentiation of human osteoblast-like cells in vitro.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23537995 2013 Evidence of colorectal cancer risk associated variant Lys25Ser in the proximity of human bone morphogenetic protein 2.
23528838 2013 Cartilage oligomeric matrix protein enhances osteogenesis by directly binding and activating bone morphogenetic protein-2.
23506588 2013 A single nucleotide polymorphism in the human bone morphogenetic protein-2 gene (109T > G) affects the Smad signaling pathway and the predisposition to ossification of the posterior longitudinal ligament of the spine.
23461810 2013 Controlled delivery of low-dose bone morphogenetic protein-2 using heparin-conjugated fibrin in the posterolateral lumbar fusion of rabbits.
23429681 2013 Characterizing the host response to rhBMP-2 in a rat spinal arthrodesis model.
23423222 2013 RAS/MEK-independent gene expression reveals BMP2-related malignant phenotypes in the Nf1-deficient MPNST.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23360788 2013 High-concentration of BMP2 reduces cell proliferation and increases apoptosis via DKK1 and SOST in human primary periosteal cells.
23359411 2013 Activation and promotion of adipose stem cells by tumour necrosis factor-? preconditioning for bone regeneration.
23341458 2013 The factor VII-activating protease (FSAP) enhances the activity of bone morphogenetic protein-2 (BMP-2).
23313904 2013 Continuous bone morphogenetic protein-2 gradients for concentration effect studies on C2C12 osteogenic fate.
23276457 2013 Med19 promotes bone metastasis and invasiveness of bladder urothelial carcinoma via bone morphogenetic protein 2.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23239467 2013 Wnt pathway regulation by demineralized bone is approximated by both BMP-2 and TGF-?1 signaling.
23192572 2013 Effect of rhBMP-2 and VEGF in a vascularized bone allotransplant experimental model based on surgical neoangiogenesis.
23161572 2013 BMP2/BMP4 colorectal cancer susceptibility loci in northern and southern European populations.
23160099 2012 A genome-wide association study identifies susceptibility loci for nonsyndromic sagittal craniosynostosis near BMP2 and within BBS9.
23150675 2013 Myotubularin-related protein 4 (MTMR4) attenuates BMP/Dpp signaling by dephosphorylation of Smad proteins.
23142810 2013 WNT4 acts downstream of BMP2 and functions via ?-catenin signaling pathway to regulate human endometrial stromal cell differentiation.
23122408 2013 Folding and dimerization kinetics of bone morphogenetic protein-2, a member of the transforming growth factor-? family.
23088504 2013 Modulation of BMP-2-induced chondrogenic versus osteogenic differentiation of human mesenchymal stem cells by cell-specific extracellular matrices.
23079991 2012 Phenotype characterization and sequence analysis of BMP2 and BMP4 variants in two Mexican families with oligodontia.
23023810 2013 Effects of recombinant human bone morphogenic protein-2 and human bone marrow-derived stromal cells on in vivo bone regeneration of chitosan-poly(ethylene oxide) hydrogel.
23017834 2012 Lentiviral-mediated gene transfer into human adipose-derived stem cells: role of NELL1 versus BMP2 in osteogenesis and adipogenesis in vitro.
23010719 2012 SHP is involved in BMP2-induced odontoblast differentiation.
22965927 2012 Cleft palate in a multigenerational family with a microdeletion of 20p12.3 involving BMP2.
22961954 2013 In vitro and in vivo studies of rhBMP2-coated PS/PCL fibrous scaffolds for bone regeneration.
22958403 2012 Transforming growth factor ?1 inhibits bone morphogenic protein (BMP)-2 and BMP-7 signaling via upregulation of Ski-related novel protein N (SnoN): possible mechanism for the failure of BMP therapy?
22894570 2013 Enhanced control of in vivo bone formation with surface functionalized alginate microbeads incorporating heparin and human bone morphogenetic protein-2.
22886971 2012 Synthesis and characterization of UPPE-PLGA-rhBMP2 scaffolds for bone regeneration.
22791809 2012 Helicobacter pylori and the BMP pathway regulate CDX2 and SOX2 expression in gastric cells.
22778550 2012 The osteogenic study of tissue engineering bone with BMP2 and BMP7 gene-modified rat adipose-derived stem cell.
22771956 2012 Regulatory role of stromal cell-derived factor-1 in bone morphogenetic protein-2-induced chondrogenic differentiation in vitro.
22705305 2012 The role of histone chaperones in osteoblastic differentiation of C2C12 myoblasts.
22674456 2012 BMP induced inflammation: a comparison of rhBMP-7 and rhBMP-2.
22652796 2012 BMP2 induces PANC-1 cell invasion by MMP-2 overexpression through ROS and ERK.
22652428 2012 Recombinant human bone morphogenetic protein-2 released from polyurethane-based scaffolds promotes early osteogenic differentiation of human mesenchymal stem cells.
22583106 2012 Mutation of a cleavage site adjacent to the mature domain leads to increase in secreted mature BMP-2 with reduced activity.
22542719 2012 Bone morphogenetic protein-2 will be a novel biochemical marker in urinary tract infections and stone formation.
22540193 2012 BMP2 and mechanical loading cooperatively regulate immediate early signalling events in the BMP pathway.
22496405 2012 BMP-2 induces a profibrotic phenotype in adult renal progenitor cells through Nox4 activation.
22450430 2014 AntagomiR directed against miR-20a restores functional BMPR2 signalling and prevents vascular remodelling in hypoxia-induced pulmonary hypertension.
22366399 2012 Ubc9 negatively regulates BMP-mediated osteoblastic differentiation in cultured cells.
22359486 2012 Effect of bone morphogenetic protein-2 on proliferation and apoptosis of gastric cancer cells.
22323359 2012 TMPRSS6, but not TF, TFR2 or BMP2 variants are associated with increased risk of iron-deficiency anemia.
22310349 2011 Recombinant human bone morphogenetic protein-2 as an adjunct for spine fusion in a pediatric population.
22270235 2012 BMP2 promotes migration and invasion of breast cancer cells via cytoskeletal reorganization and adhesion decrease: an AFM investigation.
22227436 2012 Bone marrow-derived heparan sulfate potentiates the osteogenic activity of bone morphogenetic protein-2 (BMP-2).
22119392 2012 BMP-2 inhibits TF expression in human monocytes by shutting down MAPK signaling and AP-1 transcriptional activity.
22102412 2012 BMP2 protein regulates osteocalcin expression via Runx2-mediated Atf6 gene transcription.
21998741 2011 Differential growth factor adsorption to calvarial osteoblast-secreted extracellular matrices instructs osteoblastic behavior.
21923031 2011 [Relationship between the bone mass and the expressions of vascular endothelial growth factor, basic fibroblast growth factor, and bone morphogenetic protein 2 mRNA in avascular necrosis of femoral head].
21907184 2011 Bone morphogenetic protein-2 activates NADPH oxidase to increase endoplasmic reticulum stress and human coronary artery smooth muscle cell calcification.
21885439 2011 Lung tumor-associated osteoblast-derived bone morphogenetic protein-2 increased epithelial-to-mesenchymal transition of cancer by Runx2/Snail signaling pathway.
21876344 2011 mRNA expression of bone morphogenetic proteins and their receptors in human renal cell carcinoma.
21842277 2011 Mechanical loading stimulates BMP7, but not BMP2, production by osteocytes.
21777514 2011 Combination of Runx2 and BMP2 increases conversion of human ligamentum flavum cells into osteoblastic cells.
21755409 2011 The additive effect of mesenchymal stem cells and bone morphogenetic protein 2 on ?-irradiated bone marrow in mice.
21720209 mRNA expression profiling reveals conserved and non-conserved miR-140 targets.
21702718 2011 Divergent activities of osteogenic BMP2, and tenogenic BMP12 and BMP13 independent of receptor binding affinities.
21688537 2011 [Comparative study of serum levels of BMP-2 and heterotopic ossification in traumatic brain injury and fractures patients].
21688312 2012 BMP-2 mediates PGE(2) -induced reduction of proliferation and osteogenic differentiation of human tendon stem cells.
21688123 2012 Bovine lactoferrin induces interleukin-11 production in a hepatitis mouse model and human intestinal myofibroblasts.
21673630 2011 Fusion performance of low-dose recombinant human bone morphogenetic protein 2 and bone marrow-derived multipotent stromal cells in biodegradable scaffolds: a comparative study in a large animal model of anterior lumbar interbody fusion.
21660578 2011 Osteogenic and angiogenic effects of mesenchymal stromal cells with co-transfected human Ang-1 gene and BMP2 gene.
21659661 2011 Opposing effects of bone morphogenetic protein-2 and endothelin-1 on lung fibroblast chloride currents.
21655089 2011 Multiple common susceptibility variants near BMP pathway loci GREM1, BMP4, and BMP2 explain part of the missing heritability of colorectal cancer.
21570392 2011 Metastatic function of BMP-2 in gastric cancer cells: the role of PI3K/AKT, MAPK, the NF-?B pathway, and MMP-9 expression.
21471203 2011 Notch signaling pathway enhances bone morphogenetic protein 2 (BMP2) responsiveness of Msx2 gene to induce osteogenic differentiation and mineralization of vascular smooth muscle cells.
21415150 2011 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
21401418 2011 Retinoic acid receptor ?-dependent signaling cooperates with BMP2 to induce osteoblastic differentiation of C2C12 cells.
21347550 2011 BMP-2 gene modified canine bMSCs promote ectopic bone formation mediated by a nonviral PEI derivative.
21327739 2012 The serum bone morphogenetic protein-2 level in non-small-cell lung cancer patients.
21311046 2011 Differential Notch signaling in the epicardium is required for cardiac inflow development and coronary vessel morphogenesis.
21308777 2011 Phospho-Smad1 modulation by nedd4 E3 ligase in BMP/TGF-? signaling.
21308375 2011 Bone Morphogenic Protein--mRNA upregulation after exposure to low frequency electric field.
21285872 2011 Patterns of bone morphogenetic protein-2 expression in smooth muscle tumors of the uterine corpus and other uterine tissues.
21277338 2011 DNA methylation restricts spontaneous multi-lineage differentiation of mesenchymal progenitor cells, but is stable during growth factor-induced terminal differentiation.
21254281 2011 Recombinant human bone morphogenetic protein-2 and pancreatic cancer: a retrospective cohort study.
21247344 2011 High doses of bone morphogenetic protein 2 induce structurally abnormal bone and inflammation in vivo.
21212630 2011 BMP-2 and TGF?2 shared pathways regulate endocardial cell transformation.
21205918 2011 Tumor necrosis factor-? accelerates the calcification of human aortic valve interstitial cells obtained from patients with calcific aortic valve stenosis via the BMP2-Dlx5 pathway.
21128211 2010 Lack of effect of bone morphogenetic protein 2 and 4 gene polymorphisms on bone density in postmenopausal Turkish women.
21121067 2010 Effect of high glucose levels on the calcification of vascular smooth muscle cells by inducing osteoblastic differentiation and intracellular calcium deposition via BMP-2/Cbf?-1 pathway.
21096864 2010 Effect of sustained release of bone morphogenetic protein on osteogenic expression of mesenchymal stem cells.
21084396 2011 Leiomyoma simultaneously impair endometrial BMP-2-mediated decidualization and anticoagulant expression through secretion of TGF-?3.
21054789 2010 WFIKKN1 and WFIKKN2 bind growth factors TGF?1, BMP2 and BMP4 but do not inhibit their signalling activity.
20939477 2010 [Study on relationship between osteoporosis and mRNA expressions of vascular endothelial growth factor and bone morphogenetic protein 2 in nontraumatic avascular necrosis of femoral head].
20927405 2010 A selection fit mechanism in BMP receptor IA as a possible source for BMP ligand-receptor promiscuity.
20890042 2010 Integration of a Notch-dependent mesenchymal gene program and Bmp2-driven cell invasiveness regulates murine cardiac valve formation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20874259 2011 Enhancement of bone morphogenetic protein-2-induced ectopic bone formation by transforming growth factor-?1.
20860622 2010 DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-? superfamily proteins.
20848249 2011 Activation of the PI3K/Akt pathway mediates bone morphogenetic protein 2-induced invasion of pancreatic cancer cells Panc-1.
20843790 2010 The canonical BMP signaling pathway plays a crucial part in stimulation of dentin sialophosphoprotein expression by BMP-2.
20838369 2011 Complications with recombinant human bone morphogenic protein-2 in posterolateral spine fusion: a consecutive series of 1037 cases.
20825377 2011 Bone morphogenetic protein-2 (BMP-2) increases gene expression of FSH receptor and aromatase and decreases gene expression of LH receptor and StAR in human granulosa cells.
20818491 2010 Repair of orbital wall defects using biocoral scaffolds combined with bone marrow stem cells enhanced by human bone morphogenetic protein-2 in a canine model.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20730440 2011 Genetic factors responsible for long bone fractures non-union.
20721706 2010 RUNX2 polymorphisms associated with OPLL and OLF in the Han population.
20684029 2011 WISP-1/CCN4 regulates osteogenesis by enhancing BMP-2 activity.
20682677 2010 Association of bone morphogenetic proteins with spinal fusion in ankylosing spondylitis.
20679527 2010 In anemia of multiple myeloma, hepcidin is induced by increased bone morphogenetic protein 2.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20670444 2010 Association between expression of the bone morphogenetic proteins 2 and 7 in the repair of circumscribed cartilage lesions with clinical outcome.
20668165 2010 PDZRN3 negatively regulates BMP-2-induced osteoblast differentiation through inhibition of Wnt signaling.
20659471 2010 Genetic heterogeneity in colorectal cancer associations between African and European americans.
20651281 2010 Paracrine osteogenic signals via bone morphogenetic protein-2 accelerate the atherosclerotic intimal calcification in vivo.
20637325 2010 Epinephrine accelerates osteoblastic differentiation by enhancing bone morphogenetic protein signaling through a cAMP/protein kinase A signaling pathway.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20587070 2010 Expression of bone morphogenetic protein-2 and its receptors in epithelial ovarian cancer and their influence on the prognosis of ovarian cancer patients.
20576608 2010 MicroRNA-208 modulates BMP-2-stimulated mouse preosteoblast differentiation by directly targeting V-ets erythroblastosis virus E26 oncogene homolog 1.
20567515 2010 BMP-2/6 heterodimer is more effective than BMP-2 or BMP-6 homodimers as inductor of differentiation of human embryonic stem cells.
20565259 2010 Complement regulator-acquiring surface protein 1 of Borrelia burgdorferi binds to human bone morphogenic protein 2, several extracellular matrix proteins, and plasminogen.
20555025 2010 Posttranslational activation of bone morphogenetic protein 2 is mediated by proprotein convertase 6 during decidualization for pregnancy establishment.
20548225 2010 Influence on the osteogenic activity of the human bone marrow mesenchymal stem cells transfected by liposome-mediated recombinant plasmid pIRES-hBMP2-hVEGF165 in vitro.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20546278 2010 Investigation of the association of BMP gene variants with nephropathy in Type 1 diabetes mellitus.
20537331 2010 Bone morphogenetic protein-2 may represent the molecular link between oxidative stress and vascular stiffness in chronic kidney disease.
20530805 2010 Soluble repulsive guidance molecule c/hemojuvelin is a broad spectrum bone morphogenetic protein (BMP) antagonist and inhibits both BMP2- and BMP6-mediated signaling and gene expression.
20506112 2010 BMP signaling in the human fetal ovary is developmentally regulated and promotes primordial germ cell apoptosis.
20505824 2010 Agrin binds BMP2, BMP4 and TGFbeta1.
20432444 2010 Adiponectin increases BMP-2 expression in osteoblasts via AdipoR receptor signaling pathway.
20432245 2010 A conserved post-transcriptional BMP2 switch in lung cells.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20348041 2010 Bone morphogenetic protein 2 stimulates endochondral ossification by regulating periosteal cell fate during bone repair.
20346918 2010 Elevated extracellular calcium increases expression of bone morphogenetic protein-2 gene via a calcium channel and ERK pathway in human dental pulp cells.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20304956 2010 Epithelial to mesenchymal transition in human skin wound healing is induced by tumor necrosis factor-alpha through bone morphogenic protein-2.
20302941 2010 A novel TWO-STEP renaturation procedure for efficient production of recombinant BMP-2.
20237276 2010 Identification of a Smad4/YY1-recognized and BMP2-responsive transcriptional regulatory module in the promoter of mouse GABA transporter subtype I (Gat1) gene.
20232298 2010 Hypoxia induces BMP-2 expression via ILK, Akt, mTOR, and HIF-1 pathways in osteoblasts.
20065295 2010 Neogenin inhibits HJV secretion and regulates BMP-induced hepcidin expression and iron homeostasis.
20060812 2010 Repressive BMP2 gene regulatory elements near the BMP2 promoter.
20041271 2010 The efficacy of rhBMP-2 versus autograft for posterolateral lumbar spine fusion in elderly patients.
20039267 2010 Bone morphogenetic protein 2 and dexamethasone synergistically increase alkaline phosphatase levels through JAK/STAT signaling in C3H10T1/2 cells.
20014079 2010 Biological activity of extracellular matrix-associated BMP-2.
19953937 2009 [Expression of bone morphogenetic protein-2 in fetal membranes from pregnant women with premature rupture of membranes and its clinic significance].
19924575 2010 Bone morphogenetic protein-2 levels are elevated in the patients with gastric cancer and correlate with disease progression.
19918795 2010 Endoglin is involved in BMP-2-induced osteogenic differentiation of periodontal ligament cells through a pathway independent of Smad-1/5/8 phosphorylation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909214 2010 Differential effects of growth differentiation factor-5 on porcine dental papilla- and follicle-derived cells.
19879168 2010 A common SNP near BMP2 is associated with severity of the iron burden in HFE p.C282Y homozygous patients: a follow-up study.
19857615 2010 Osteo-transcriptomics of human mesenchymal stem cells: accelerated gene expression and osteoblast differentiation induced by vitamin D reveals c-MYC as an enhancer of BMP2-induced osteogenesis.
19835871 2010 BMP2 accelerates the motility and invasiveness of gastric cancer cells via activation of the phosphatidylinositol 3-kinase (PI3K)/Akt pathway.
19811499 2010 Independent and cooperative roles of tumor necrosis factor-alpha, nuclear factor-kappaB, and bone morphogenetic protein-2 in regulation of metastasis and osteomimicry of prostate cancer cells and differentiation and mineralization of MC3T3-E1 osteoblast-like cells.
19804412 2009 The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding.
19800879 2010 M-Ras is activated by bone morphogenetic protein-2 and participates in osteoblastic determination, differentiation, and transdifferentiation.
19799789 2009 Hypertrophy is induced during the in vitro chondrogenic differentiation of human mesenchymal stem cells by bone morphogenetic protein-2 and bone morphogenetic protein-4 gene transfer.
19797419 2009 Expression pattern and clinical prognostic relevance of bone morphogenetic protein-2 in human gliomas.
19782107 2009 GDF5 and BMP2 inhibit apoptosis via activation of BMPR2 and subsequent stabilization of XIAP.
19762079 2009 The effects of rhBMP-2 released from biodegradable polyurethane/microsphere composite scaffolds on new bone formation in rat femora.
19754224 2010 Vascular endothelial growth factor inhibits bone morphogenetic protein 2 expression in rat mesenchymal stem cells.
19736317 2009 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate.
19713532 2009 S100A4 and bone morphogenetic protein-2 codependently induce vascular smooth muscle cell migration via phospho-extracellular signal-regulated kinase and chloride intracellular channel 4.
19699244 2009 Release characteristics and osteogenic activity of recombinant human bone morphogenetic protein-2 grafted to novel self-assembled poly(lactide-co-glycolide fumarate) nanoparticles.
19693635 2009 Complications of recombinant human BMP-2 for treating complex tibial plateau fractures: a preliminary report.
19670606 2009 [Expression and localization of macrophages and BMP2 in mucosa of tympanosclerosis].
19664780 2009 Bone morphogenic protein 2 induces Runx2 and osteopontin expression in human aortic valve interstitial cells: role of Smad1 and extracellular signal-regulated kinase 1/2.
19655815 2009 'Two-stage double-technique hybrid (TSDTH)' identification strategy for the analysis of BMP2-induced transdifferentiation of premyoblast C2C12 cells to osteoblast.
19653054 2009 Can rhBMP-2 containing collagen sponges enhance bone repair in ovariectomized rats?: a preliminary study.
19639199 2009 Inhibition of PI3 kinase/Akt pathway is required for BMP2-induced EMT and invasion.
19609629 2009 Stimulation of ectopic bone formation in response to BMP-2 by Rho kinase inhibitor: a pilot study.
19584291 2009 Bone morphogenetic proteins 2 and 5 are down-regulated in adrenocortical carcinoma and modulate adrenal cell proliferation and steroidogenesis.
19582526 2009 Successful spinal fusion by E. coli-derived BMP-2-adsorbed porous beta-TCP granules: a pilot study.
19492344 2009 Differences in fat and muscle mass associated with a functional human polymorphism in a post-transcriptional BMP2 gene regulatory element.
19473100 2009 Bone morphogenetic protein signaling is involved in human mesenchymal stem cell survival in serum-free medium.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19438813 2009 Derivation of a novel undifferentiated human foetal phenotype in serum-free cultures with BMP-2.
19375587 2009 Bone morphogenetic protein-2 activity is regulated by secreted phosphoprotein-24 kd, an extracellular pseudoreceptor, the gene for which maps to a region of the human genome important for bone quality.
19341710 2009 Bone morphogenetic protein-2 down-regulates miR-206 expression by blocking its maturation process.
19327734 2009 Duplications involving a conserved regulatory element downstream of BMP2 are associated with brachydactyly type A2.
19324883 2009 The orphan nuclear receptor estrogen receptor-related receptor gamma negatively regulates BMP2-induced osteoblast differentiation and bone formation.
19324447 2009 The positive correlation between gene expression of the two angiogenic factors: VEGF and BMP-2 in lung cancer patients.
19301257 2009 Osteoblastic bone formation is induced by using nanogel-crosslinking hydrogel as novel scaffold for bone growth factor.
19281856 2009 The effects of shockwave on bone healing and systemic concentrations of nitric oxide (NO), TGF-beta1, VEGF and BMP-2 in long bone non-unions.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19240369 Apoptosis induction and reduced proliferation in human osteoblasts by rhBMP-2, -4 and -7.
19238726 2008 In vitro response of primary human bone marrow stromal cells to recombinant human bone morphogenic protein-2 in the early and late stages of osteoblast differentiation.
19231972 2009 Differential effects of bone morphogenetic protein-2 and transforming growth factor-beta1 on gene expression of collagen-modifying enzymes in human adipose tissue-derived mesenchymal stem cells.
19229295 2009 Crystal structure analysis reveals a spring-loaded latch as molecular mechanism for GDF-5-type I receptor specificity.
19140318 [NF-kappaB modulates activation of the BMP-2 gene by trichostatin A].
19139264 2009 Bone morphogenetic protein 2 induces pulmonary angiogenesis via Wnt-beta-catenin and Wnt-RhoA-Rac1 pathways.
19123988 Humoral bone morphogenetic protein 2 is sufficient for inducing breast cancer microcalcification.
19113914 2009 SOX9 directly binds CREB as a novel synergism with the PKA pathway in BMP-2-induced osteochondrogenic differentiation.
19112539 2008 Influence of poly(L-lactic acid) nanofibers and BMP-2-containing poly(L-lactic acid) nanofibers on growth and osteogenic differentiation of human mesenchymal stem cells.
19098993 2008 Bone morphogenetic protein-2: a potential regulator in scleral remodeling.
19080362 2008 Association between two polymorphisms of the bone morpho-genetic protein-2 gene with genetic susceptibility to ossification of the posterior longitudinal ligament of the cervical spine and its severity.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
19058174 2009 Altered relative expression of BMPs and BMP inhibitors in cartilaginous areas of human fractures progressing towards nonunion.
19038372 2009 Bone morphogenetic protein-2 enhances the motility of chondrosarcoma cells via activation of matrix metalloproteinase-13.
19023570 2009 Regional and cellular localisation of BMPs and their inhibitors' expression in human fractures.
19018606 2009 rhBMP-2 modulation of gene expression in infected segmental bone defects.
18950289 2009 BMP-2 enhances TGF-beta3-mediated chondrogenic differentiation of human bone marrow multipotent mesenchymal stromal cells in alginate bead culture.
18937504 2008 The solution structure of BMPR-IA reveals a local disorder-to-order transition upon BMP-2 binding.
18818419 2008 Bone morphogenetic proteins 2 and 4 are selectively expressed by late outgrowth endothelial progenitor cells and promote neoangiogenesis.
18812404 2009 20p12.3 microdeletion predisposes to Wolff-Parkinson-White syndrome with variable neurocognitive deficits.
18773965 2008 RNA interference of the BMPR-IB gene blocks BMP-2-induced osteogenic gene expression in human bone cells.
18720410 2008 BMP-2 increases migration of human chondrosarcoma cells via PI3K/Akt pathway.
18720162 2008 Bone morphogenetic protein-2 stimulates chondrogenic expression in human nasal chondrocytes expanded in vitro.
18703506 2008 Species-specific cis-regulatory elements in the 3'-untranslated region direct alternative polyadenylation of bone morphogenetic protein 2 mRNA.
18600473 2009 Regulation of melanin synthesis by the TGF-beta family in B16 melanoma cells.
18586671 2008 TSG-6 regulates bone remodeling through inhibition of osteoblastogenesis and osteoclast activation.
18546152 2008 Proteomic profiling of CHO cells with enhanced rhBMP-2 productivity following co-expression of PACEsol.
18545679 2008 Gremlin enhances the determined path to cardiomyogenesis.
18512729 2008 Osteoblasts-derived BMP-2 enhances the motility of prostate cancer cells via activation of integrins.
18510873 2008 Soluble expression and purification of synthetic human bone morphogenetic protein-2 in Escherichia coli.
18490653 2008 cAMP/PKA pathway activation in human mesenchymal stem cells in vitro results in robust bone formation in vivo.
18471510 2008 The bone morphogenetic protein pathway is inactivated in the majority of sporadic colorectal cancers.
18465455 Relationship of bone morphogenetic proteins to disease activity and radiographic damage in patients with ankylosing spondylitis.
18436533 2008 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
18434375 2008 A distinct cohort of the TGFbeta superfamily members expressed in human endometrium regulate decidualization.
18426824 2008 Variation in the bone morphogenetic protein-2 gene: effects on fat and lean body mass in young and elderly women.
18404105 2008 Comparison of human mesenchymal stem cells derived from adipose tissue and bone marrow for ex vivo gene therapy in rat spinal fusion model.
18400943 2008 Cross-talk between fibroblast growth factor and bone morphogenetic proteins regulates gap junction-mediated intercellular communication in lens cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18389292 2008 Association of bone morphogenetic protein-2 gene polymorphisms with susceptibility to ossification of the posterior longitudinal ligament of the spine and its severity in Chinese patients.
18382765 2008 An antiproliferative BMP-2/PPARgamma/apoE axis in human and murine SMCs and its role in pulmonary hypertension.
18339631 2008 Targeting of bone morphogenetic protein growth factor complexes to fibrillin.
18335997 2008 Neogenin interacts with hemojuvelin through its two membrane-proximal fibronectin type III domains.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18311072 2008 Pioglitazone can downregulate bone morphogenetic protein-2 expression induced by high glucose in human umbilical vein endothelial cells.
18287331 2008 Selective binding of RGMc/hemojuvelin, a key protein in systemic iron metabolism, to BMP-2 and neogenin.
18184661 2008 Bone morphogenetic proteins signal through the transforming growth factor-beta type III receptor.
18179800 2008 BMP-2 promotes phosphate uptake, phenotypic modulation, and calcification of human vascular smooth muscle cells.
18160401 2008 Structure analysis of bone morphogenetic protein-2 type I receptor complexes reveals a mechanism of receptor inactivation in juvenile polyposis syndrome.
18156628 2008 HtrA1 inhibits mineral deposition by osteoblasts: requirement for the protease and PDZ domains.
18059158 2007 BMP suppresses PTEN expression via RAS/ERK signaling.
18059017 2008 Mycoplasma infection transforms normal lung cells and induces bone morphogenetic protein 2 expression by post-transcriptional mechanisms.
18029192 2007 Bone morphogenetic protein (BMP)-7 but not BMP-2 and BMP-4 improves maintenance of primitive peripheral blood-derived hematopoietic progenitor cells (HPC) cultured in serum-free medium supplemented with early acting cytokines.
18021008 2008 Association of bone morphogenetic proteins with otosclerosis.
17997109 2008 TGFbeta ligands promote the initiation of retinal ganglion cell dendrites in vitro and in vivo.
17992660 2008 Regulation of bone morphogenetic protein signalling in human pulmonary vascular development.
17960657 2008 Immunomodulatory and osteogenic differentiation effects of mesenchymal stem cells by adenovirus-mediated coexpression of CTLA4Ig and BMP2.
17919499 2007 The effect of statins in colorectal cancer is mediated through the bone morphogenetic protein pathway.
17847004 2007 Common variants in the BMP2, BMP4, and HJV genes of the hepcidin regulation pathway modulate HFE hemochromatosis penetrance.
17824831 2007 STRO-1 selected rat dental pulp stem cells transfected with adenoviral-mediated human bone morphogenetic protein 2 gene show enhanced odontogenic differentiation.
17726567 2007 Variation in the BMP2 gene: bone mineral density and ultrasound in young adult and elderly women.
17711857 2007 Bone morphogenetic protein 2 functions via a conserved signaling pathway involving Wnt4 to regulate uterine decidualization in the mouse and the human.
17681894 2007 Prostaglandin E2 EP4 agonist (ONO-4819) accelerates BMP-induced osteoblastic differentiation.
17656261 2007 Bone morphogenic factor gene dosage abnormalities in prostatic intraepithelial neoplasia and prostate cancer.
17617489 2007 Periodontal regeneration using novel glycidyl methacrylated dextran (Dex-GMA)/gelatin scaffolds containing microspheres loaded with bone morphogenetic proteins.
17608624 2008 Osteogenic effects of bone-morphogenetic-protein-2 plasmid gene transfer.
17577985 2007 [Expression of recombinant human BMP6 in CHO cells by fused to the signal peptide and propeptide of another homologue protein].
17553463 2007 Post-translational modifications of collagen upon BMP-induced osteoblast differentiation.
17549388 2007 Bone morphogenetic protein-2 and -9 regulate the interaction of insulin-like growth factor-I with growth plate chondrocytes.
17530715 2007 Chondrogenic differentiation of bovine synovium: bone morphogenetic proteins 2 and 7 and transforming growth factor beta1 induce the formation of different types of cartilaginous tissue.
17519894 2007 Mesenchymal stem cell-mediated gene delivery of bone morphogenetic protein-2 in an articular fracture model.
17518682 2006 Osteogenic differentiation of human mesenchymal stem cells in collagen matrices: effect of uniaxial cyclic tensile strain on bone morphogenetic protein (BMP-2) mRNA expression.
17504062 2007 Skull bone regeneration in nonhuman primates by controlled release of bone morphogenetic protein-2 from a biodegradable hydrogel.
17472960 2007 Repulsive guidance molecule RGMa alters utilization of bone morphogenetic protein (BMP) type II receptors by BMP2 and BMP4.
17437303 2007 Uptake of nickel from 316L stainless steel into contacting osteoblastic cells and metal ion interference with BMP-2-induced alkaline phosphatase.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
17401695 2007 Bone formation zones in heterotopic ossifications: histologic findings and increased expression of bone morphogenetic protein 2 and transforming growth factors beta2 and beta3.
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17262821 2007 Immunohistochemical localization of bone morphogenetic proteins (BMPs) 2, 4, 6, and 7 during induced heterotopic bone formation.
17255107 2007 Bone morphogenetic protein 1 prodomain specifically binds and regulates signaling by bone morphogenetic proteins 2 and 4.
17244894 2007 Antagonistic effects of bone morphogenetic protein-4 and -7 on renal mesangial cell proliferation induced by aldosterone through MAPK activation.
17240342 2007 Glypican LON-2 is a conserved negative regulator of BMP-like signaling in Caenorhabditis elegans.
17202865 2006 BMP-2-enhanced chondrogenesis involves p38 MAPK-mediated down-regulation of Wnt-7a pathway.
17168321 2006 [Expression, characterization and biological activity analysis of recombinant human bone morphogenetic protein 2 in CHO cells].
17138967 2007 The extracellular calcium-sensing receptor reciprocally regulates the secretion of BMP-2 and the BMP antagonist Noggin in colonic myofibroblasts.
17120779 2006 Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation.
17029022 2006 Bone morphogenetic proteins and their antagonists.
17003113 2006 Bone morphogenetic protein antagonist gremlin 1 is widely expressed by cancer-associated stromal cells and can promote tumor cell proliferation.
16893455 2006 Activation of WNT and BMP signaling in adult human articular cartilage following mechanical injury.
16835229 2006 Pro-inflammatory cytokine tumor necrosis factor-alpha induces bone morphogenetic protein-2 in chondrocytes via mRNA stabilization and transcriptional up-regulation.
16815889 2006 Bone morphogenetic protein-2 upregulates expression and function of voltage-gated K+ channels in human pulmonary artery smooth muscle cells.
16771708 2006 Tumour necrosis factor alpha-stimulated gene-6 inhibits osteoblastic differentiation of human mesenchymal stem cells induced by osteogenic differentiation medium and BMP-2.
16754660 2006 Heparin potentiates the in vivo ectopic bone formation induced by bone morphogenetic protein-2.
16753015 2006 BMP-2 gene polymorphisms and osteoporosis: the Rotterdam Study.
16719933 2006 Expression of bioactive bone morphogenetic proteins in the subacromial bursa of patients with chronic degeneration of the rotator cuff.
16672363 2006 Structure of the ternary signaling complex of a TGF-beta superfamily member.
16637042 2006 Porous silk fibroin 3-D scaffolds for delivery of bone morphogenetic protein-2 in vitro and in vivo.
16621789 2006 A dishevelled-1/Smad1 interaction couples WNT and bone morphogenetic protein signaling pathways in uncommitted bone marrow stromal cells.
16615932 2006 HIV-1 Tat interaction with cyclin T1 represses mannose receptor and the bone morphogenetic protein receptor-2 transcription.
16613856 2006 Bone morphogenetic protein-2 stimulates Runx2 acetylation.
16604289 2006 Single-nucleotide polymorphisms and haplotypes of bone morphogenetic protein genes and peripheral bone mineral density in young Korean men and women.
16604073 2006 Bone morphogenetic protein signaling by hemojuvelin regulates hepcidin expression.
16598384 2006 BMP signaling is required for RUNX2-dependent induction of the osteoblast phenotype.
16453284 2006 Reproducible genetic associations between candidate genes and clinical knee osteoarthritis in men and women.
16442268 2006 Bone morphogenetic protein-2 modulates Wnt and frizzled expression and enhances the canonical pathway of Wnt signaling in normal keratinocytes.
16433617 2005 Insulin-like growth factor-I induces early osteoblast gene expression in human mesenchymal stem cells.
16432645 2006 Polymorphisms in the bone morphogenetic protein 2 (BMP2) gene do not affect bone mineral density in white men or women.
16391828 2006 Alteration of gene expression in response to bone morphogenetic protein-2 in androgen-dependent human prostate cancer LNCaP cells.
16326713 2006 Extracellular matrix-mediated signaling by dentin phosphophoryn involves activation of the Smad pathway independent of bone morphogenetic protein.
16261446 2005 BMP-2 prevents apoptosis of the N1511 chondrocytic cell line through PI3K/Akt-mediated NF-kappaB activation.
16247476 2006 Bone morphogenetic protein 2 stimulation of tumor growth involves the activation of Smad-1/5.
16243309 2005 Bmp signaling promotes intermediate mesoderm gene expression in a dose-dependent, cell-autonomous and translation-dependent manner.
16194878 BMP-2-modulated chondrogenic differentiation in vitro involves down-regulation of membrane-bound beta-catenin.
16157126 2005 Expression of bone morphogenetic protein 2 in normal spontaneous labor at term, preterm labor, and preterm premature rupture of membranes.
16150699 2005 Cross-talk between Wnt and bone morphogenetic protein 2 (BMP-2) signaling in differentiation pathway of C2C12 myoblasts.
16126463 2006 Overexpression of noggin inhibits BMP-mediated growth of osteolytic prostate cancer lesions.
16049014 2005 Identification of receptors and signaling pathways for orphan bone morphogenetic protein/growth differentiation factor ligands based on genomic analyses.
16000303 2005 BMP-2 and insulin-like growth factor-I mediate Osterix (Osx) expression in human mesenchymal stem cells via the MAPK and protein kinase D signaling pathways.
15861517 2005 Expression of bone morphogenetic proteins in human metastatic prostate and breast cancer.
15851600 2005 Regulation of bone morphogenetic protein-2 expression in endothelial cells: role of nuclear factor-kappaB activation by tumor necrosis factor-alpha, H2O2, and high intravascular pressure.
15671031 2005 DRAGON, a bone morphogenetic protein co-receptor.
15647840 2005 Bone morphogenetic protein-2 induces hypophosphorylation of Rb protein and repression of E2F in androgen-treated LNCaP human prostate cancer cells.
15647827 2005 Alphavbeta integrins play an essential role in BMP-2 induction of osteoblast differentiation.
15641068 2005 Use of bone morphogenetic protein 2 and diffusion chambers to engineer cartilage tissue for the repair of defects in articular cartilage.
15621726 2004 Bone morphogenetic proteins.
15592496 2005 Tenascin-W is found in malignant mammary tumors, promotes alpha8 integrin-dependent motility and requires p38MAPK activity for BMP-2 and TNF-alpha induced expression in vitro.
15358784 2004 Conservation of Bmp2 post-transcriptional regulatory mechanisms.
15322112 2004 Myogenin protein stability is decreased by BMP-2 through a mechanism implicating Id1.
15254224 2004 Bone morphogenetic protein 2-induced osteoblast differentiation requires Smad-mediated down-regulation of Cdk6.
15240857 2004 Sudden infant death syndrome: case-control frequency differences at genes pertinent to early autonomic nervous system embryologic development.
15150273 2004 Menin is required for bone morphogenetic protein 2- and transforming growth factor beta-regulated osteoblastic differentiation through interaction with Smads and Runx2.
15110716 2004 Bone morphogenetic protein-2 can mediate myocardial regulation of atrioventricular cushion mesenchymal cell formation in mice.
15102076 2004 Type II collagen accumulation in overlying dermo-epidermal junction of pilomatricoma is mediated by bone morphogenetic protein 2 and 4.
15064755 2004 Molecular recognition of BMP-2 and BMP receptor IA.
15042598 2004 Loss of BMP2, Smad8, and Smad4 expression in prostate cancer progression.
15039429 2004 Protein related to DAN and cerberus is a bone morphogenetic protein antagonist that participates in ovarian paracrine regulation.
15037653 2004 Bone morphogenetic protein-2 stimulates angiogenesis in developing tumors.
15020244 2004 USAG-1: a bone morphogenetic protein antagonist abundantly expressed in the kidney.
14699493 2004 Bone morphogenetic protein 2 is expressed by, and acts upon, mature epithelial cells in the colon.
14691541 2003 Linkage of osteoporosis to chromosome 20p12 and association to BMP2.
14660436 2004 A novel chordin-like BMP inhibitor, CHL2, expressed preferentially in chondrocytes of developing cartilage and osteoarthritic joint cartilage.
14623234 2003 Identification of a secreted BMP antagonist, ectodin, integrating BMP, FGF, and SHH signals from the tooth enamel knot.
14587031 2003 Matrix GLA protein and BMP-2 regulate osteoinduction in calcifying vascular cells.
14558086 2003 Bone morphogenetic proteins 2 and 6, expressed in arthritic synovium, are regulated by proinflammatory cytokines and differentially modulate fibroblast-like synoviocyte apoptosis.
14499589 2003 Activation of osteo-progenitor cells by a novel synthetic peptide derived from the bone morphogenetic protein-2 knuckle epitope.
13678785 2003 Bone morphogenetic protein 2 induces placental growth factor in mesenchymal stem cells.
12933820 2003 Brief bone morphogenetic protein 2 treatment of glucocorticoid-inhibited MC3T3-E1 osteoblasts rescues commitment-associated cell cycle and mineralization without alteration of Runx2.
12925611 2003 Stimulation of BMP-2 expression by pro-inflammatory cytokines IL-1 and TNF-alpha in normal and osteoarthritic chondrocytes.
12919699 2003 A gene expression profile for endochondral bone formation: oligonucleotide microarrays establish novel connections between known genes and BMP-2-induced bone formation in mouse quadriceps.
12897139 2003 BMPER, a novel endothelial cell precursor-derived protein, antagonizes bone morphogenetic protein signaling and endothelial cell differentiation.
12872164 2003 BMP-2 mediates retinoid-induced apoptosis in medulloblastoma cells through a paracrine effect.
12856332 2003 Interleukin-11 acts synergistically with bone morphogenetic protein-2 to accelerate bone formation in a rat ectopic model.
12854828 2003 Bone morphogenetic protein-2 restores mineralization in glucocorticoid-inhibited MC3T3-E1 osteoblast cultures.
12819188 2003 The mature bone morphogenetic protein-2 is aberrantly expressed in non-small cell lung carcinomas and stimulates tumor growth of A549 cells.
12740218 2003 Bone morphogenetic proteins induce apoptosis in human pulmonary vascular smooth muscle cells.
12620973 2003 BMP2 exposure results in decreased PTEN protein degradation and increased PTEN levels.
12535648 2003 A kinase-inactive type II TGFbeta receptor impairs BMP signaling in human breast cancer cells.
12531697 2003 Regulation of human erythropoiesis by activin A, BMP2, and BMP4, members of the TGFbeta family.
12527559 2003 BMP-2 inhibits proliferation of human aortic smooth muscle cells via p21Cip1/Waf1.
12489168 2002 Bone morphogenetic protein 2 induces the expression of cementum attachment protein in human periodontal ligament clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12210753 2002 Systemically administered rhBMP-2 promotes MSC activity and reverses bone and cartilage loss in osteopenic mice.
12168799 2002 Regulation of human cranial osteoblast phenotype by FGF-2, FGFR-2 and BMP-2 signaling.
12126644 2002 Site-specific interaction of bone morphogenetic protein 2 with procollagen II.
12082094 2002 Functions of transforming growth factor-beta family type I receptors and Smad proteins in the hypertrophic maturation and osteoblastic differentiation of chondrocytes.
12052447 2002 Bone morphogenetic protein-2 coating of titanium implants increases biomechanical strength and accelerates bone remodeling in fracture treatment: a biomechanical and histological study in rats.
12002771 2002 Bone morphogenetic protein (BMP)-2 induces apoptosis in human myeloma cells.
11968014 2002 Real-time quantitative RT-PCR analysis of human bone marrow stromal cells during osteogenic differentiation in vitro.
11953135 2002 [Effects of recombinant human bone morphogenic protein-2 and hyaluronic acid on invasion of brain glioma in vivo].
11837817 2002 Human skeletal muscle cells in ex vivo gene therapy to deliver bone morphogenetic protein-2.
11811554 2002 Stimulation of Smad1 transcriptional activity by Ras-extracellular signal-regulated kinase pathway: a possible mechanism for collagen-dependent osteoblastic differentiation.
11792561 2002 Macrophage cell lines produce osteoinductive signals that include bone morphogenetic protein-2.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11748585 2001 BMP-2 and BMP-9 promotes chondrogenic differentiation of human multipotential mesenchymal cells and overcomes the inhibitory effect of IL-1.
11741887 2002 Matrix GLA protein, a regulatory protein for bone morphogenetic protein-2.
11642720 2001 Transcriptional mRNA of BMP-2, 3, 4 and 5 in trigeminal nerve, benign and malignant peripheral nerve sheath tumors.
11502704 2001 Altered growth responses of pulmonary artery smooth muscle cells from patients with primary pulmonary hypertension to transforming growth factor-beta(1) and bone morphogenetic proteins.
11497252 Bone morphogenetic protein-2 and type IV collagen expression in psammoma body forming ovarian cancer.
11456401 2001 Interaction of TGF-beta1 and rhBMP-2 on human bone marrow stromal cells cultured in collagen gel matrix.
11263668 2001 The crystal structure of the BMP-2:BMPR-IA complex and the generation of BMP-2 antagonists.
11180925 2000 Effects of bone morphogenetic protein-2 on human tumor cell growth and differentiation: a preliminary report.
10881198 2000 Crystal structure of the BMP-2-BRIA ectodomain complex.
10880444 2000 BMP-2 antagonists emerge from alterations in the low-affinity binding epitope for receptor BMPR-II.
10704850 2000 BMP2 is required for early heart development during a distinct time period.
10692589 2000 Isolation of recombinant BMP receptor IA ectodomain and its 2:1 complex with BMP-2.
10657699 2000 Noggin is a negative regulator of neuronal differentiation in developing neocortex.
10220513 1999 Bone morphogenetic protein 2 exerts diverse effects on cell growth in vitro and is expressed in human pancreatic cancer in vivo.
10196167 1999 Bone morphogenetic protein 2 inhibits platelet-derived growth factor-induced c-fos gene transcription and DNA synthesis in mesangial cells. Involvement of mitogen-activated protein kinase.
10085302 1999 Type IIA procollagen containing the cysteine-rich amino propeptide is deposited in the extracellular matrix of prechondrogenic tissue and binds to TGF-beta1 and BMP-2.
10074410 1999 Crystal structure of human bone morphogenetic protein-2 at 2.7 A resolution.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9693150 1998 Regulation of BMP7 expression during kidney development.
9493905 1998 Bone morphogenetic protein-2 and transforming growth factor-beta2 interact to modulate human bone marrow stromal cell proliferation and differentiation.
9265423 1997 Direct isoform analysis of high-mannose-containing glycoproteins by on-line capillary electrophoresis electrospray mass spectrometry.
9213002 1997 Effect of rhBMP-2 on the osteogenic potential of bone marrow stromal cells from an osteogenesis imperfecta mouse (oim).
9197246 1997 MASH1 maintains competence for BMP2-induced neuronal differentiation in post-migratory neural crest cells.
9187146 1997 Bone morphogenetic proteins (BMPs) as regulators of dorsal forebrain development.
8752214 1996 The Spemann organizer signal noggin binds and inactivates bone morphogenetic protein 4.
8413626 1993 The daf-4 gene encodes a bone morphogenetic protein receptor controlling C. elegans dauer larva development.
8006002 1994 Identification of type I receptors for osteogenic protein-1 and bone morphogenetic protein-4.
7811286 1994 A mammalian serine/threonine kinase receptor specifically binds BMP-2 and BMP-4.
3201241 1988 Novel regulators of bone formation: molecular clones and activities.
2376592 1990 Bovine osteogenic protein is composed of dimers of OP-1 and BMP-2A, two members of the transforming growth factor-beta superfamily.
2315314 1990 Recombinant human bone morphogenetic protein induces bone formation.
2004778 1991 Bone morphogenetic protein: chromosomal localization of human genes for BMP1, BMP2A, and BMP3.
1487246 1992 The gene for bone morphogenetic protein 2A (BMP2A) is localized to human chromosome 20p12 by radioactive and nonradioactive in situ hybridization.