Property Summary

NCBI Gene PubMed Count 563
PubMed Score 4647.88
PubTator Score 2601.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Refractive error 50 0.0 3.0

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease -1.194 1.4e-02
astrocytic glioma 2.300 5.2e-03
Astrocytoma, Pilocytic 2.000 1.4e-08
Atopic dermatitis -1.300 4.0e-05
colon cancer -2.600 3.8e-03
cutaneous lupus erythematosus -1.400 6.1e-03
ductal carcinoma in situ -2.100 1.4e-03
ependymoma 2.500 2.0e-03
esophageal adenocarcinoma 1.100 2.5e-02
glioblastoma 1.100 2.7e-03
group 4 medulloblastoma -1.100 4.9e-04
interstitial cystitis -2.700 1.4e-03
intraductal papillary-mucinous neoplasm ... 2.000 3.0e-02
invasive ductal carcinoma -2.500 4.8e-03
lung adenocarcinoma -1.200 3.6e-05
lung cancer -1.200 1.2e-02
lung carcinoma -1.300 1.4e-07
malignant mesothelioma -8.300 3.2e-09
nasopharyngeal carcinoma 1.200 1.3e-02
non-small cell lung cancer -2.133 1.5e-14
oligodendroglioma 3.600 2.3e-03
osteosarcoma 2.013 9.9e-03
ovarian cancer -3.300 1.0e-19
pediatric high grade glioma 1.500 4.1e-03
psoriasis -1.600 6.6e-04
spina bifida -1.068 4.0e-02

Gene RIF (491)

AA Sequence

MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPS      1 - 70
RDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIP     71 - 140
TEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVT    141 - 210
PAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKRE    211 - 280
KRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVN    281 - 350
SVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR                            351 - 396
//

Text Mined References (565)

PMID Year Title