Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.73
PubTator Score 14.35

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
permanent atrial fibrillation -1.700 8.9e-03

Gene RIF (13)

PMID Text
26631724 The Prodomain-bound Form of Bone Morphogenetic Protein 10 Is Biologically Active on Endothelial Cells.
24551273 BMP10, is elevated in the stenotic colon segment of Hirschsprung disease patients, and BMP10 signaling may play a pivotal role in disease development.
23645739 Low expression of bone morphogenetic protein-10 is associated with urothelial cancer of the bladder.
21737454 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21550985 Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608934 Bone morphogenetic protein-10 (BMP-10) may function as a tumor suppressor in breast cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17921333 Hypertension induced expression of prohypertrophic BMP10, and the hypertrophic effect of BMP10 was modulated, at least in part, by its binding to Tcap at the Z disc.
10072785 Describes the cloning and expression of murine BMP-10.

AA Sequence

MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSD      1 - 70
IPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEV     71 - 140
IMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRW    141 - 210
QKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLP    211 - 280
ELDNLGLDSFSSGPGEEALLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAY    281 - 350
ECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSE    351 - 420
CGCR                                                                      421 - 424
//

Text Mined References (20)

PMID Year Title
26631724 2016 The Prodomain-bound Form of Bone Morphogenetic Protein 10 Is Biologically Active on Endothelial Cells.
24551273 2014 Expression analysis of BMP2, BMP5, BMP10 in human colon tissues from Hirschsprung disease patients.
23645739 2013 Expression of bone morphogenetic protein-10 (BMP10) in human urothelial cancer of the bladder and its effects on the aggressiveness of bladder cancer cells in vitro.
21737454 2011 Soluble endoglin specifically binds bone morphogenetic proteins 9 and 10 via its orphan domain, inhibits blood vessel formation, and suppresses tumor growth.
21550985 2011 Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20608934 2010 Bone morphogenetic protein-10 (BMP-10) inhibits aggressiveness of breast cancer cells and correlates with poor prognosis in breast cancer.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903896 2010 ALK1 signaling regulates early postnatal lymphatic vessel development.
18339631 2008 Targeting of bone morphogenetic protein growth factor complexes to fibrillin.
17921333 2007 Interaction of BMP10 with Tcap may modulate the course of hypertensive cardiac hypertrophy.
17068149 2007 Identification of BMP9 and BMP10 as functional activators of the orphan activin receptor-like kinase 1 (ALK1) in endothelial cells.
16049014 2005 Identification of receptors and signaling pathways for orphan bone morphogenetic protein/growth differentiation factor ligands based on genomic analyses.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072785 1999 Heart specific expression of mouse BMP-10 a novel member of the TGF-beta superfamily.