Property Summary

NCBI Gene PubMed Count 66
PubMed Score 220.09
PubTator Score 1790.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.300 1.7e-06
osteosarcoma 1.885 5.7e-06
posterior fossa group A ependymoma 1.400 5.0e-07
atypical teratoid / rhabdoid tumor 1.200 3.5e-05
glioblastoma 2.000 5.6e-07
medulloblastoma, large-cell 1.400 7.1e-05
non-small cell lung cancer 1.378 5.4e-15
lung cancer -1.800 9.1e-04
active Crohn's disease -1.032 7.0e-03
interstitial cystitis 1.400 4.5e-05
pediatric high grade glioma 1.300 1.4e-04
lung carcinoma -1.300 3.3e-10
ovarian cancer -1.300 1.3e-06

 CSPA Cell Line (1)

Gene RIF (45)

PMID Text
26592459 Studies indicate crosstalk between Notch receptor and Wnt protein, Hedgehog protein, hypoxia and transforming growth factor beta (TGFbeta)/bone morphogenetic protein (BMP) pathways.
25701650 Data indicate that BMP-1 can simultaneously trigger matrix assembly and boost the synthesis of matrix proteins via a direct effect on growth factors in the contexts of development, growth and tissue repair. [review]
25656619 study thus highlights the severe and progressive nature of BMP1-associated OI in adults and broadens insights into the functional consequences of BMP1/mTLD-deficiency on ECM organization.
25402547 Two novel variants in the BMP1 gene: c.808A>G and c.1297G>T care associated with osteogenesis imperfecta.
25214535 Frequent bone fracture in children is cause by BMP1-1 deficiency.
25158199 mutations of the DSP-PP P4 to P4' cleavage site can block, impair or accelerate dentin sialoprotein phosphophoryn cleavage, and suggest that its Bone morphogenic protein 1 cleavage site is conserved in order to regulate its cleavage efficiency
24984282 High BMP1 expression is associated with type-1 diabetes.
24042462 Loss of bone morphogenetic protein is associated with prostate cancer.
23640157 Sequence analysis of BMP1 genes did not reveal any putative mutations for hyperostosis cranialis interna to chromosome 8p21
23584484 miR-194 suppresses metastasis of non-small cell lung cancer through regulating expression of BMP1 and p27kip1
22860217 Controlling inhibition of bone morphogenetic protein (BMP1) modulates the number of SOX1 expressing cells, whereas PAX6, another neural precursor marker, remains the same.
22482805 The molecular and cellular bases of BMP1-dependent osteogenesis were defined. The importance of BMP1 for bone formation and stability were shown in humans and zebrafish.
22052668 We conclude that BMP1 is an additional gene mutated in autosomal recessive osteogenesis imperfecta (AR-OI).
21946044 High expression of BMP pathway genes are associated with atypical teratoid/rhabdoid tumors.
21897187 Excluding anterior cervical fusions, there are no significant differences between spinal fusion procedures with and without BMP-associated overall complications.
21697095 Bone morphogenetic protein-1 processes insulin-like growth factor-binding protein 3.
21453682 BMP1-3 is a novel systemic regulator of bone repair.
21415150 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
21258932 Disruption of BMPR1A-mediated BMP1 signalling during the narrow window of early embryogenesis may interfere with normal VBW formation, causing omphalocele phenotype in the Cd chick model.
20955454 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20026052 Three isoforms of BMP1 ranging from the shortest BMP1-5 to the longest (mTLD, inefficient at processing procollagen in vitro) were all shown to be capable of removing the highly conserved propeptides from both proDCN.
19801683 Data show that only those containing both PCPE1 CUB1 and CUB2 were capable of enhancing BMP-1 activity and binding to a mini-procollagen substrate with nanomolar affinity.
19617627 FN binds BMP1-like proteinases in vivo and that FN is an important determinant of the in vivo activity levels of BMP1-like proteinases.
19323056 Regulation of alternative splicing of mRNA for procollagen C-endopeptidase in leiomyomas and myometrium depends mainly on the hormonal status of women
19305382 BMP-1 expression was significantly higher in thyroid tumors with psammoma bodies or with stromal calcification.
18854154 Knockdown of bone morphogenetic protein 1 (BMP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18824173 The crystal structures of the protease domains of human BMP-1 and the closely related Tolloid-like protease 1 (TLL-1), are reported.
18349123 Expression of BMP1, BMP6, BMP7, and BMP-receptor 2 was significantly increased in advanced stages of myelofibrosis compared and enhanced levels of BMP6 expression were already evident in prefibrotic stages of primary myelofibrosis.
18056036 vascular Bmp Msx2 Wnt signaling and oxidative stress have roles in arterial calcification [review]
17548836 BMP1 processes PRL to a 17-kDa anti-angiogenic factor.
17516847 data support the concept that the C-terminal domains of BMP1 are important for substrate recognition and for controlling and restricting its proteolytic activity via exosite binding
17407447 By mutating residues flanking the cleavage site of collagen type V alpha 1, we showed that the aspartate residue at position P2' is essential for BMP-1 activity.
17255107 the BMP1 prodomain specifically binds and regulates signaling by BMP2 and BMP4
17071617 bone morphogenetic protein 1 is inhibited by native and altered forms of alpha2-macroglobulin
16507574 tolloid-like 1 binds procollagen C-proteinase enhancer protein 1 and differs from bone morphogenetic protein 1 in the functional roles of homologous protein domains
15857508 BMP-1 is upregulated in human epithelial cells by HIV-1 Tat treatment
15817489 chordinase activity of BMP1 is not enhanced by PCPE-1
15591058 cleaves LG3 from recombinant endorepellin at the physiologically relevant site and cleaves LG3 from endogenous perlecan in cultured mouse and human cells
15225209 Dermal wound healing in red Duroc pigs show unique mRNA expression of HSP47,BMP-1,TIMP1-3 and hypercontracted,hyperpigmented scars.
12637569 Pro-BMP-1 is cleaved in the trans-Golgi network
12637537 the minimal domain structure for PCP activity is considerably shorter than expected and comprises the metalloproteinase domain and the CUB1 and CUB2 domains of BMP-1
12218058 Post-translational modification is required for secretion and stability of the protein.
11986329 bone morphogenetic protein-1 (BMP-1), which exhibits procollagen C-proteinase activity, cleaves the C-terminal propeptide from human procollagen VII

AA Sequence

MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQ      1 - 70
AVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG     71 - 140
GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGI    141 - 210
VVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG    211 - 280
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW    281 - 350
RISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS    351 - 420
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAY    421 - 490
DYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCE    491 - 560
QRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRIS    561 - 630
LQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHF    631 - 700
FSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSK    701 - 770
KECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR    771 - 840
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFE    841 - 910
VEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQD    911 - 980
TLHSRK                                                                    981 - 986
//

Text Mined References (68)

PMID Year Title
26592459 2016 The Notch intracellular domain integrates signals from Wnt, Hedgehog, TGF?/BMP and hypoxia pathways.
25701650 BMP-1/tolloid-like proteinases synchronize matrix assembly with growth factor activation to promote morphogenesis and tissue remodeling.
25656619 2015 Defective Proteolytic Processing of Fibrillar Procollagens and Prodecorin Due to Biallelic BMP1 Mutations Results in a Severe, Progressive Form of Osteogenesis Imperfecta.
25543063 2015 K153R polymorphism in myostatin gene increases the rate of promyostatin activation by furin.
25402547 2015 Identification and in vivo functional characterization of novel compound heterozygous BMP1 variants in osteogenesis imperfecta.
25214535 2015 A polyadenylation site variant causes transcript-specific BMP1 deficiency and frequent fractures in children.
25158199 2014 Site specificity of DSP-PP cleavage by BMP1.
24984282 2014 Placental antiangiogenic prolactin fragments are increased in human and rat maternal diabetes.
24042462 2013 Contextual effect of repression of bone morphogenetic protein activity in prostate cancer.
23829672 2013 Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2.
23640157 2013 Localization of the gene for hyperostosis cranialis interna to chromosome 8p21 with analysis of three candidate genes.
23584484 2014 miR-194 suppresses metastasis of non-small cell lung cancer through regulating expression of BMP1 and p27(kip1).
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
22860217 2012 DMH1, a highly selective small molecule BMP inhibitor promotes neurogenesis of hiPSCs: comparison of PAX6 and SOX1 expression during neural induction.
22482805 2012 Attenuated BMP1 function compromises osteogenesis, leading to bone fragility in humans and zebrafish.
22052668 2012 Identification of a mutation causing deficient BMP1/mTLD proteolytic activity in autosomal recessive osteogenesis imperfecta.
21946044 2011 High expression of BMP pathway genes distinguishes a subset of atypical teratoid/rhabdoid tumors associated with shorter survival.
21897187 2011 Does bone morphogenetic protein increase the incidence of perioperative complications in spinal fusion? A comparison of 55,862 cases of spinal fusion with and without bone morphogenetic protein.
21697095 2011 Bone morphogenetic protein-1 processes insulin-like growth factor-binding protein 3.
21453682 2011 Bone morphogenetic protein (BMP)1-3 enhances bone repair.
21415150 2011 Circulating bone morphogenetic protein 1-3 isoform increases renal fibrosis.
21258932 2011 BMPR1A-mediated BMP1 signalling is disrupted in the cadmium-induced omphalocele in the chick model.
20955454 2010 Somatic frameshift mutations of bone morphogenic protein receptor 2 gene in gastric and colorectal cancers with microsatellite instability.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20026052 2010 Decorin is processed by three isoforms of bone morphogenetic protein-1 (BMP1).
19801683 2009 Strong cooperativity and loose geometry between CUB domains are the basis for procollagen c-proteinase enhancer activity.
19617627 2009 Fibronectin binds and enhances the activity of bone morphogenetic protein 1.
19323056 2009 [Changes of mRNAs encoding alternatively spliced variants of procollagen C-endopeptidase in leiomyomas uteri depending on the phase of menstrual cycle and in postmenopausal women].
19305382 2009 Survival impact of psammoma body, stromal calcification, and bone formation in papillary thyroid carcinoma.
18824173 2008 Structural basis for the substrate specificity of bone morphogenetic protein 1/tolloid-like metalloproteases.
18349123 2008 Bone morphogenetic proteins are overexpressed in the bone marrow of primary myelofibrosis and are apparently induced by fibrogenic cytokines.
18056036 2007 Vascular Bmp Msx2 Wnt signaling and oxidative stress in arterial calcification.
17548836 2007 Bone morphogenetic protein 1 processes prolactin to a 17-kDa antiangiogenic factor.
17516847 2007 The protease domain of procollagen C-proteinase (BMP1) lacks substrate selectivity, which is conferred by non-proteolytic domains.
17407447 2007 Enzymatic cleavage specificity of the proalpha1(V) chain processing analysed by site-directed mutagenesis.
17255107 2007 Bone morphogenetic protein 1 prodomain specifically binds and regulates signaling by bone morphogenetic proteins 2 and 4.
17071617 2006 Inhibition of bone morphogenetic protein 1 by native and altered forms of alpha2-macroglobulin.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16507574 2006 Mammalian tolloid-like 1 binds procollagen C-proteinase enhancer protein 1 and differs from bone morphogenetic protein 1 in the functional roles of homologous protein domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15817489 2005 Identification of the minimal domain structure of bone morphogenetic protein-1 (BMP-1) for chordinase activity: chordinase activity is not enhanced by procollagen C-proteinase enhancer-1 (PCPE-1).
15591058 2005 BMP-1/Tolloid-like metalloproteases process endorepellin, the angiostatic C-terminal fragment of perlecan.
15525470 2004 Yeast two-hybrid screening for proteins that interact with alpha1-adrenergic receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225209 Molecular, histologic, and gross phenotype of skin wound healing in red Duroc pigs reveals an abnormal healing phenotype of hypercontracted, hyperpigmented scarring.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12637569 2003 Paired basic/Furin-like proprotein convertase cleavage of Pro-BMP-1 in the trans-Golgi network.
12637537 2003 Bone morphogenetic protein-1 (BMP-1). Identification of the minimal domain structure for procollagen C-proteinase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393877 2002 PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1.
12218058 2002 Post-translational modification of bone morphogenetic protein-1 is required for secretion and stability of the protein.
11986329 2002 Proteinases of the bone morphogenetic protein-1 family convert procollagen VII to mature anchoring fibril collagen.
11741999 2002 Biosynthetic processing of the pro-alpha 1(V)2pro-alpha 2(V) collagen heterotrimer by bone morphogenetic protein-1 and furin-like proprotein convertases.
11283002 2001 Identification of amino acid residues in bone morphogenetic protein-1 important for procollagen C-proteinase activity.
11260715 2001 Homologues of Twisted gastrulation are extracellular cofactors in antagonism of BMP signalling.
10806203 2000 Bone morphogenetic protein 1 is an extracellular processing enzyme of the laminin 5 gamma 2 chain.
10479448 1999 Mammalian BMP-1/Tolloid-related metalloproteinases, including novel family member mammalian Tolloid-like 2, have differential enzymatic activities and distributions of expression relevant to patterning and skeletogenesis.
9500680 1998 Three alternatively spliced variants of the gene coding for the human bone morphogenetic protein-1.
8643539 1996 The C-proteinase that processes procollagens to fibrillar collagens is identical to the protein previously identified as bone morphogenic protein-1.
8553073 1996 Bone morphogenetic protein-1: the type I procollagen C-proteinase.
8530106 1995 Structural organization and genetic localization of the human bone morphogenetic protein 1/mammalian tolloid gene.
8404039 1993 Mapping of the bone morphogenetic protein 1 gene (BMP1) to 8p21: removal of BMP1 from candidacy for the bone disorder in Langer-Giedion syndrome.
7798260 1994 Bone morphogenetic protein-1 and a mammalian tolloid homologue (mTld) are encoded by alternatively spliced transcripts which are differentially expressed in some tissues.
3201241 1988 Novel regulators of bone formation: molecular clones and activities.
2004778 1991 Bone morphogenetic protein: chromosomal localization of human genes for BMP1, BMP2A, and BMP3.