Property Summary

NCBI Gene PubMed Count 358
PubMed Score 691.33
PubTator Score 657.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.500 6.4e-05
breast carcinoma 1.100 3.9e-03
ovarian cancer -1.500 3.3e-05
dermatomyositis 1.200 2.0e-03

Gene RIF (319)

PMID Text
26935956 Data indicate that overexpression of polycomb complex protein BMI-1 (BMI-1) in multiple myeloma (MM) highlighting its role as an attractive drug target.
26763885 These data show that BMI1 regulates cell proliferation, apoptosis, and differentiation of human mesenchymal stem cells.
26690524 Overexpression of CD133 mRNA and BMI1 protein was found in 47.6 and 76.2% patients respectively.
26679841 up-regulation or down-regulation of BMI1 induced resistance or sensitivity to BRAF inhibitor treatment and that induction of noncanonical Wnt by BMI1 is required for this resistance
26633535 BMI1 ubiquitinates histone H2A and gammaH2AX, thereby facilitating the repair of double-stranded DNA breaks through stimulating homologous recombination and non-homologous end joining. [review]
26623561 Data show that PTC-209 caused an up-regulation of BMI1 on mRNA level, BMI1 protein levels were clearly reduced after PTC-209 treatment.
26578590 The polycomb complex proteins BMI1 and RING1A regulate the ubiquitination of chromatin associated proteins bound to promoters.
26573774 These results provide important insights into the role of Bmi-1 in the occurrence and development of nasopharyngeal carcinoma
26573508 MKK3 overexpression upregulated the cyclin-dependent kinase inhibitors, p16 INK4A and p15 INK4B in hepatocellular carcinoma cells was Bim1, was downregulated following MKK3 overexpression.
26517683 Data show that increased polycomb repressive complex 2 EZH2 and/or polycomb repressive complex 1 BMI1 expression repress the expression of microRNA miR-200 family members.
26489630 Bmi1 is a potential driver oncogene of bladder cancer, and it may become a potential treatment target for human bladder cancer.
26468281 These observations suggest a dynamic and developmentally regulated model of PRC1 occupancy at constitutive heterochromatin, and where BMI1 function in somatic cells is to stabilize the repetitive genome
26452029 Results provide functional and mechanistic links between Hes1 and Bmi-1/PTEN/Akt/GSK3beta signaling in the development and progression of colon cancer.
26343356 Data show that polycomb-group proteins BMI1, PHC3, CBX6 and CBX7 expression was significantly increased during imatinib treatment.
26316085 MiR-452 modulated BMI1 expression.
26261549 Co-silencing of Bmi-1 and hTERT using siRNA technology may be an effective treatment for breast cancer.
26238021 These results suggested that U-87 MG cells exhibited radioresistance. High doses of X-ray radiation increased the expression levels of Bmi-1, which may be associated with the evasion of cellular senescence.
26202447 Hypoxia upregulated the expression of Twist1, Bmi1, epithelialmesenchymal transition markers, stem cell markers and vasculogenic mimicry associated markers in hepatocellular carcinoma cells.
26191215 Rapamycin induced growth inhibition of human retinoblastoma cells, and inactive of mTOR pathway and downregulation of Bmi-1 was involved in its action mechanism.
26151332 The enzymatic activity of BMI1 and RING1B were evaluated and compared.
26110620 Immunohistochemical staining of primary and metastatic osteosarcoma tumors revealed strong nuclear expression of BMI1.
26090866 activated microRNA-494-targets Bmi1 and ADAM10 by silibinin and ablates cancer stemness in head and neck squamous cell carcinomas
26081615 It was found that CD133(+) cells existed in primary human laryngeal tumor with enhanced capacity of proliferation and invasion. Bmi-1, implicated in self-renewal and tumorigenesis, was coexpressed with the CD133.
26043676 The results showed that BMI1 and ZEB1 are important factors in association with the promotion of EMT and invasion of tongue squamous cell carcinoma
26023734 ERalpha inhibits epithelial-mesenchymal transition and stemness through the downregulation of Bmi1 in breast cancer
25968877 Bmi1 might serve as a novel and effective prognostic biomarker in gastric cancer, and could be a promising emerging molecular target in gastric cancer therapy.
25967457 High BMI1 expression is associated with bladder cancer cell proliferation, migration, and invasion.
25967455 High peritumoral Bmi-1 expression is associated with renal cell carcinoma.
25922517 findings establish that MOZ and BMI1 play opposing roles during the onset of Hox gene expression in the ES cell model and during body segment identity specification in vivo.
25915207 PODXL up-regulates the expression level of Bmi1 in OTSCC cells.
25903073 knock-down of miR-200c or overexpression of Bmi1 in BRAF inhibitors-sensitive melanoma cells activates the PI3K/AKT and MAPK pathways.
25899063 Increased expression of BMI1 is associated with metastatic capability of immunoedited tumor cells.
25880371 Bmi-1 level accumulates strongly in early stage and then declines in late stage, which is potentially important for NSCLC cell invasion and metastasis during progression.
25858624 There is a notable relationship between the over-expression of BMI1 and the carcinogenesis of gliomas. The silence of BMI1 inhibited cell proliferation and enhanced the apoptosis of U251 cells and increased the sensitivity of U251 cells to cisplatin.
25853770 MK3 modulation affects BMI1-dependent and independent cell cycle check-points
25843776 The Bmi-1 RF and HT domains are required for Bmi-1 protein function in skin cancer cells and that a mechanism responsible for loss of activity in thesemutants is a reduced ability to interact with and activate the Ring1B ubiquitin ligase.
25775580 miR-215 is a link between CDX1 expression and BMI1 repression that governs differentiation in colorectal cancer
25761682 MiR-221 and miR-30d repress prostate cancer cell proliferation, and this effect is partially rescued by Bmi-1 overexpression.
25751743 Bmi1 limits dilated cardiomyopathy and heart failure by inhibiting cardiac senescence.
25737447 BMI1 acts as a repressor of miR-31 transcription, suggesting a cross-negative feedback loop between the expression of miR-31 and BMI1.
25726526 We provide evidence that COX4-1 controls BMI1 expression via a redox mechanism
25663545 BITC-mediated inhibition of bCSC was augmented by knockdown of Notch4 and Nicastrin, but not by RNA interference of Notch1 or Notch2.
25552924 Bmi1 drives stem-like properties and is associated with migration, invasion, and poor prognosis in tongue squamous cell carcinoma.
25547677 Bmi-1 mRNA levels were significantly associated with survival. Cox analysis indicated Bmi-1 mRNA was an independent prognostic factor for overall survival.
25526772 This study demonstrated that BMI1 is over-expressed in pediatric gliomas, particularly in high-grade malignant gliomas, in both CD133+ and CD133- cells.
25505268 PLK1 inhibition down-regulates polycomb group protein BMI1 via modulation of the miR-200c/141 cluster
25501509 the inhibitory effect of PTP on the cell growth was at least in part mediated via the downregulation of Bmi-1 expression and the telomerase activity in OVCAR-3 cells, and PTP might be a new candidate for chemotherapeutic agent against human ovarian cancer
25475727 miR-203 regulates melanoma invasive and proliferative abilities in part by targeting BMI1
25458792 In this meta-analysis, high expression of BMI1 was associated with poor survival in Asian patients with numerous forms of cancer, while high levels of expression in Caucasian patients was predictive of breast cancer.
25451922 BAP1 deficiency causes increased expression of FoxK2 target genes in a Ring1B-Bmi1-dependent manner
25385494 BMI1 expression in human hematopoietic stem and progenitor cells from patients with DBA is correlated with the expression of some ribosomal protein genes, suggesting that BMI1 deficiency may play a pathological role in DBA and other ribosomopathies.
25367080 miR-200c appears to control the epithelial-to-mesenchymal transition process through BMI-1 in bladder cancer cells, and it inhibits their proliferation through down-regulating E2F3.
25348805 Our study showed that Bmi1 is overexpressed in several high-grade, invasive ductal breast adenocarcinomas, thus supporting its role as a prognostic marker.
25333742 EE-JXY can inhibit the proliferation of HCC partially via suppression of the Bmi1 and Wnt/beta-catenin signaling pathways
25286028 Bmi1 serves as a key driver and biomarker with multiple oncogenic functions underlying tongue tumorigenesis.
25262972 Downregulation of Bmi-1 promotes the expression of the tumor suppressor p16, which is important in glioma cell motility.
25252846 Bmi-1 promotes glioma cell migration and invasion via NF-kappaB-mediated upregulation of MMP-3.
25243792 found that expression of PcG proteins and H3K27me3 showed prognostic value in our study cohort
25241082 CD133(+) cancer stem cells were chemoresistant and BMI-1 was highly expressed in these CD133(+) cells
25185265 Two different BMI1-containing PcG complexes regulate hematopoietic stem cell activity, which are distinguishable by the presence of UBAP2L.
25148045 prognostic value of ALDH-1, Bmi-1 and Nanog stem cell markers in esophageal squamous cell carcinoma.
25131797 conclude that p21/cyclin E pathway is crucial in modulating the anticlastogenic function of Bmi-1
25110121 BMI-1 mRNA expression in HCC was significantly higher than that in non-cancerous tissues.
25109303 Alteration of miR-183 expression may regulate the function of pancreatic ductal adenocarcinoma cells by the downregulation of Bmi-1 expression.
25088203 Data provide compelling evidence that BMI1 decreases etoposide-induced G2/M checkpoint activation via reducing NBS1-mediated ATM activation.
25084695 BMI1 expression levels can predict the survival of acute myeloid leukemia patients and monitor the aggressiveness and progression in patients with chronic disease.
25031724 Knockdown of Bmi-1 expression induces epithelial-to-mesenchymal transition in breast cancer cells
25013381 The results demonstrate that miR-135a targets Bmi1 in pancreatic ductal adenocarcinoma.
25009285 Bmi1 expression is regulated by hypoxia-inducible factor-1a (HIF-1a) under low oxygen.
24927072 Data suggest that Bmi-1 downregulation increases the radiosensitivity to CD44+ nasopharyngeal cancer stem-like cells.
24915841 Bmi-1 plays a critical role in protection from renal tubulointerstitial injury by maintaining redox balance.
24913180 Our data suggest that Bmi-1 may serve as an important novel therapeutic target in multiple myeloma.
24909638 It is a epithelial-mesenchymal transition promoting transcription factor and its expressionis associated with aggressiveness and poor prognosis of intraductal papillary mucinous neoplasm of pancreas.
24889242 These findings suggest an inhibitory role of BMI1 in adenovirus morphogenesis that can be implied in adenovirus tropism.
24870796 BMI1 demonstrated marked down-regulation in basal cell carcinoma compared to normal skin tissue.
24839010 miR-218 is downregulated in melanoma. By targeting CIP2A and BMI1, miR-218 regulates the proliferation, migration, and invasion of the melanoma cell lines A375 and SK-MEL-2.
24833884 The expression of Bmi-1 and PAI-1 plays a role in esophageal squamous cell carcinoma progression, and may be used as a prognostic marker in ESCC.
24800958 A promising intracellular marker of CSCs in head and neck cancer is the oncoprotein BMI1.
24719948 Bmi1 might play important roles in the development of bile duct tumor thrombi in hepatocellular carcinoma.
24709421 Cisplatin-resistant tumor stem cells expressed more Bmi-1 than cisplatin-sensitive cells.
24614341 Bmi1 and possibly RNF2 may be attractive biomarkers of gemcitabine resistance in the context of RRM1 expression.
24571310 High BMI1 reprogrammes histone acetylation and enhances c-fos pathway via directly binding to Zmym3 in malignant myeloid progression
24559156 Expression of Bmi1 is influenced by estrogen receptor alpha in the progression of breast cancer.
24460684 BMI1 controls MB cell migration and invasion through repression of the BMP pathway, raising the possibility that BMI1 could be used as a biomarker to identify groups of patients who may benefit from a treatment with BMP agonists.
24415717 The results provide evidence of increased density of ABCG2 and Bmi-1-positive populations in malignant and oral potentially malignant lesions and derived cell lines
24393364 Bmi-1 might be involved in gastric cancer at both transcription and translation levels.
24379598 Silencing Bmi-1 by RNA interference can increase the senescent cell rate and effectively reduce the metastasis of gastric cancer cells.
24342665 The study suggested correlation between increased Bmi-1 expression and clinical progression in ovarian epithelial cancer.
24337040 Bmi1 knockdown inhibited cell cycle progression through derepression of the p16INK4a/p14ARF locus and caused inhibition of cell proliferation, migration, tumor sphere formation, enhanced sensitivity to cisplatin, and cell cycle arrest in the G0/G1 phase
24317363 knockdown of Bmi-1 in PC3 and DU145 cells significantly reduced cell proliferation and upregulated the p16 tumor-suppressor
24312366 findings suggest that TAMs may cause increased Bmi1 expression through miR-30e* suppression, leading to tumor progression
24300467 Bmi1 displays higher expression in recurrent than in primary ovarian neoplasms
24292392 Downregulation of BMI-1 inhibits the ability of colorectal cancer-initiating cells to self-renew, resulting in the abrogation of their tumorigenic potential.
24252251 miR-15a inhibits cell proliferation and epithelial-mesenchymal transition in pancreatic ductal adenocarcinoma via the down-regulation of Bmi-1 expression
24219349 stem renewal factor Bmi-1 was a direct target of miR-203
24145240 Early detection marker distinguishes cancerous from non-cancerous regions in mouth squamous cell carcinoma
24139839 The data of this study suggest for the first time that the combination of Bmi1 and EZH2 overexpression may be a highly sensitive marker for the prognosis in glioma patients.
24122997 Aberrant EZH2 and BMI1 expression was significantly associated with mode of invasion, but not with lymph node metastasis or survival rate in oral squamous cell carcinoma.
24039897 MiR-200c and miR-203 overexpression in breast cancer cells downregulated Bmi1 expression accompanied with reversion of resistance to 5-Fu mediated by Bmi1.
23990442 Bmi-1 was a significant prognostic factor of poor overall survival in lung adenocarcinoma patients.
23984324 Increased expression of the Bmi-1 in pediatric brain tumors may be important in the acquisition of an aggressive phenotype.
23950210 High BMI1 expression is associated with glioma.
23873701 Identified a novel t(10;14)(p12;q32)/IGH-BMI1 rearrangement and its IGL variant in six cases of chronic lymphocytic leukemia; this study shows that BMI1 is recurrently targeted by chromosomal aberrations in B-cell leukemia/lymphoma.
23873108 Data indicate that B cell-specific Moloney murine leukaemia virus integration site 1 (BMI1) gene was co-regulated with progesterone receptor (PR) in the invasive ductal breast carcinoma.
23864317 Bmi1 and FoxF1 may cooperate with hedgehog signaling in non-small-cell lung carcinogenesis.
23820733 BMI1 may represent a novel diagnostic marker and a therapeutic target for bladder cancer, and deserves further investigation.
23807724 These data demonstrate that Bmi-1 plays a vital role in HCC invasion and that Bmi-1 is a potential therapeutic target for HCC
23744494 Single nucleotide polymorphism in BMI1-PIP4K2A is associated with Precursor B-Cell Lymphoblastic Leukemia-Lymphoma.
23727134 BMI-1 and RING1B expression was enhanced with the development of embryos in early pregnancy.
23712029 BMI-1 expression plays a role in hTERT-induced immortalisation and epithelial-mesenchymal transition.
23708658 Data indicate that post-translational phosphorylation of Nanog is essential to regulate Bmi1 and promote tumorigenesis.
23700898 Bmi-1 may contribute to malignant cell transformation, and its expression in tissues taken from patients with cervical, breast and ovarian cancer could be a marker for diagnosis and prognosis.
23686310 Upregulation of BMI1 and downregulation of miR-16 in mantle cell lymphoma (MCL) side population has a key role in the disease's progression by reducing MCL cell apoptosis.
23671559 Regulation of TCF4-mediated BCL2 gene expression by BMI1 is universal.
23601184 Sp1 and c-Myc are important transcription factors that directly bind to the BMI1 promoter region and regulate gene expression in nasopharyngeal carcinoma.
23592496 Authors assessed the functional relevance of two genes, FoxG1 and Bmi1, which were significantly enriched in non-Shh/Wnt MBs and showed these genes to mediate MB stem cell self-renewal and tumor initiation in mice.
23559850 BMI-1 might render important oncogenic property of retinoblastomas.
23525303 siRNA against Bmi-1 significantly suppresses tumor growth and induces apoptosis in vitro and in vivo.
23468063 The Bmi-1 pathway was downregulated in GBM cells.
23437065 These results implicate Bmi1 in the invasiveness and growth of pancreatic cancer and demonstrate its key role in the regulation of pancreatic cancer stem cells.
23383216 Bmi-1 promotes glioma angiogenesis by activating NF-kappaB signaling.
23308129 BMI1 could be developed as a dual bio-marker (serum and biopsy) for the diagnosis and prognosis of prostate cancer in Caucasian and African-American men.
23255074 miR-218 suppressed protein expression of BMI-1 downstream targets of cyclin-dependent kinase 4, a cell cycle regulator, while upregulating protein expression of p53.
23242307 Downregulation of the Bmi1 gene by RNAi can inhibit the proliferation and invasivesness of hepatocellular carcinoma cells.
23239878 A positive feedback loop connected by the WNT signaling pathway regulates BMI1 expression.
23204235 our results link CSCs, EMT, and CIN through the BMI1-AURKA axis
23138990 High expression of Bmi1 was associated with hepatocarcinogenesis.
23092893 Akt phosphorylates the transcriptional repressor bmi1 to block its effects on the tumor-suppressing ink4a-arf locus.
23078618 This study demonstrates that high expression Bmi-1 is associated with esophageal adenocarcinoma and precancerous lesions, which implies that Bmi-1 plays an important role in early carcinogenesis in esophageal adenocarcinoma.
23057360 The expressions of Bmi1 and hTERT genes may have a close relation to the proliferative capacity of CD34+ cells.
23046527 There was no significant correlation between p16INK4A expression and BMI1 expression.
23023333 Our results suggest that CHMP1A serves as a critical link between cytoplasmic signals and BMI1-mediated chromatin modifications that regulate proliferation of central nervous system progenitor cells.
22994774 There was higher Bmi-1 protein expression in intestinal-type carcinomas.
22982443 miR-200c overexpression resulted in significant down-regulation of BMI-1.
22967049 Knockdown of endogenous Bmi-1 reduced the invasiveness and migration of glioma cells. NF-kappaB transcriptional activity and MMP-9 expression and activity were significantly increased in Bmi-1-overexpressing but reduced in Bmi-1-silenced cells.
22912356 We found that overexpression of c-Myc was significantly associated with that of BMI1, and that patients who harbored glioblastomas overexpressing c-Myc and BMI1 showed significantly longer overall survival.
22898137 Cervical cancer with excessive BMI-1 expression possesses high metastases potential and that BMI-1 may be a promising biomarker for predicting metastasis in cervical cancer.
22872929 Bmi-1 siRNA has a role in inhibiting ovarian cancer cell line growth and decreasing telomerase activity
22863087 Coexpression of B-lymphoma Moloney murine leukemia virus insertion region-1 (BMI1) and sex-determining region of Y chromosome-related high mobility group box-2 (SOX2) may promote cervical carcinogenesis.
22842564 These results suggest that Bmi-1 plays an important role in tumor radioadaptive resistance under FIR and may be a potent molecular target for enhancing the efficacy of fractionated RT.
22825250 Structural alterations of BMI1 and downstream effectors are rare but they do occur in human myeloproliferative neoplasms.
22777769 Bmi-1 represses transcription of insulin-like growth factor-1 receptor and abrogates IGF-IR signaling in prostate cancer
22766604 Both Bmi1 and EZH2, not each alone, could be potent candidates of new target therapy in esophageal squamous cell carcinoma.
22725270 expression patterns of ALDH1 and Bmi1 in OE were associated with malignant transformation, suggesting they may be valuable predictors for evaluating risk of oral cancer.
22664532 After cisplatin treatment, Bmi1 is required for the self-renewal of stem-like cells that are important for the expansion of the stem-like cell pool in human A549 cells and that targeting Bmi1 slows down the formation of tumors in vivo.
22509111 high expression of p16(INK4a) and low expression of Bmi1 are associated with endothelial cellular senescence in human cornea.
22420951 Bmi-1 regulates key pathways involved in the metastasis of lung adenocarcinoma cells.
22384090 Bmi1 is down-regulated in the aging brain and displays antioxidant and protective activities in neurons
22366984 Bmi-1 status in breast cancer is an independent prognostic factor, which also is associated with tumor histological grade and basal-like phenotype.
22293918 Bmi-1 plays a part in autoreactive CD4+ T cell proliferative capability and apoptotic resistance in immune thrombocytopenia patients
22265735 Bmi1 expression profiles show a marked elevation in the proneural glioblastoma subtype.
22252887 BMI1, which is upregulated in a variety of cancers, has a positive correlation with clinical grade/stage and poor prognosis. [Review]
22209830 results indicate that Bmi-1 may play an important role in breast cancer radiosensitivity.
22170051 Regulation of the potential marker for intestinal cells, Bmi1, by beta-catenin and the zinc finger protein KLF4: implications for colon cancer.
22132147 Measuring BMI-1 autoantibody levels of patients with cervical cancer could have clinical prognostic value as well as a non-tissue specific biomarker for neoplasms expressing BMI-1.
22120721 report that BMI1 has a critical role in stabilizing cyclin E1 by repressing the expression of FBXW7, a substrate-recognition subunit of the SCF E3 ubiquitin ligase that targets cyclin E1 for degradation
22120066 Overexpression of BMI1 confers clonal cells resistance to apoptosis and contributes to adverse prognosis in myelodysplastic syndrome.
22096526 Results suggest that Bmi1 plays a crucial role in the maintenance of the stem cell pool in postnatal skeletal muscle and is essential for efficient muscle regeneration after injury especially after repeated muscle injury.
22040961 Expressions of ABCB1, BMI-1, HOXB4 were not detected in the patients with non-malignant hematologic diseases, but were higher in de novo acute leukemia patients and lower in patients in complete remission.
22009787 ATP-binding cassette, G2 subfamily (ABCG2) and BMI-1, predict the transformation of oral leukoplakia to cancer.
21999765 Overexpression of BMI-1 correlates with drug resistance in B-cell lymphoma cells through the stabilization of survivin expression.
21960247 a c-Myb-Bmi1 transcription-regulatory pathway is required for p190(BCR/ABL) leukemogenesis.
21919891 Epithelial-mesenchymal transition and cancer stemness: the Twist1-Bmi1 connection
21883379 Twist1 directly activates Bmi1 expression and that these two molecules function together to mediate cancer stemness and epithelial-mesenchymal transition--{REVIEW}
21866458 Bmi1 expression is associated with the clinicopathological characteristics of colorectal cancer.
21865393 Correlating with the loss of H3K27me3, human papillomavirus 16 E6/E7-expressing cells exhibited derepression of specific EZH2-, KMD6A-, and BMI1-targeted HOX genes.
21856782 dysregulation of the BMI1 gene mediated by MYCN or MYC overexpression, confers increased cell proliferation during neuroblastoma genesis and tumor progression
21851624 MicroRNA-194 inhibits epithelial to mesenchymal transition of endometrial cancer cells by targeting oncogene BMI-1.
21772249 Crystallography of a complex of the Bmi1/Ring1b RING-RING heterodimer & UbcH5c shows that UbcH5c interacts with Ring1b only. Bmi1/Ring1b interacts with nucleosomal DNA & an acidic patch on histone H4 to achieve specific monoubiquitination of H2A.
21755556 BMI1 was required to maintain the proliferative capacity of laryngeal Cancer stem cells.
21735131 simultaneous activation of USP22 and BMI-1 may associate with GC progression and therapy failure
21732356 Data indicate that the dynamics of recognition of UV-damaged chromatin, and the nuclear arrangement of BMI1 protein can be influenced by acetylation and occur as an early event prior to the recruitment of HPbeta to UV-irradiated chromatin.
21725369 correlated the expression of miR-200b, miR-15b and BMI1 with the clinicopathological status and prognosis of tongue squamous cell carcinoma patients
21685941 Knockdown experiments of Bmi1 in vitro and in vivo demonstrate that Hh signaling not only drives Bmi1 expression, but a feedback mechanism exists wherein downstream effectors of Bmi1 may, in turn, activate Hh pathway genes
21678481 It has been clearly established that BMI1 is a bonafide oncogene and plays critical roles in promoting cancer stem cell self-renewal and tumorogenesis.
21656027 Bmi-1 may be associated with the epithelial-mesenchymal transition in lung squamous cell carcinoma
21638011 A significant association between the expression of Bmi-1 and estrogen receptor was found in primary breast cancers and their metastases.
21572997 DNA methyltransferase controls stem cell aging by regulating BMI1 and EZH2 through microRNAs.(
21496667 results indicate that dMSCs lose their odontogenic differentiation potential during senescence, in part by reduced Bmi-1 expression.
21430439 F box protein betaTrCP regulates BMI1 protein turnover via ubiquitination and degradation.
21428211 Bmi-1 siliencing combined treatment of doxorubicin might be a new strategy for biological treatment on breast cancer.
21383063 BMI1 is recruited to sites of DNA DSBs, where it persists for more than 8 h. BMI1 is required for postdamage ubiquitination of histone H2A at lysine 119 and contributes to efficient homology-mediated repair of DNA breaks.
21373837 Studies indicate that new targets have recently been investigated as potential modulators in myeloid leukemia pathogenesis, including miR-328, BMI1, FOXOs and IL1RAP.
21370603 Bmi-1 might participate in the development and progression of uterine cervical cancer and have clinical potential not only as a useful predictor of aggressive phenotype but also a promising prognostic predictor.
21309753 BMI1 protein human might be an independent prognostic marker in patient diagnosed with uterine cervical cancer.
21307872 Bmi-1 elicits radioprotective effects on normal human keratino by mitigating the genotoxicity of ionizing radiation through epigenetic mechanisms.
21276221 Bmi-1 promotes invasion and metastasis, and its elevated expression is correlated with an advanced stage of breast cancer
21276135 WWOX was identified as a Bmi1 target in small cell lung cancer cells
21259057 the aim of this study was to investigate the prognosis and clinicopathologic roles of beta-catenin, Wnt1, Smad4, Hoxa9, and Bmi-1 in esophageal squamous cell carcinoma
21252986 higher expression of BMI-1 and immune responses to BMI-1 protein is associated with improved outcome following allogeneic stem cell transplantation.
21170084 a previously unrecognized link between BMI-1, contact inhibition and the Hippo-YAP pathway
21164364 Increase of BMI1 is associated with lung adenocarcinoma.
21162745 Bmi-1/Mel-18 ratio can be potentially used as a tool for stratifying women at risk of developing breast malignancy.
21152871 Bmi-1 may be a potential molecular target for the therapy of breast carcinoma.
21125401 Overexpression of the EZH2, RING1, and BMI1 genes is common in MDS and indicate poor prognosis. The products of these genes might participate in epigenetic regulation of Myelodysplastic syndrome.
21113618 C-MYC and BMI-1 expression was detected in stromal cells only
21059209 Decreased Mel-18 and increased Bmi-1 mRNA expression was associated with the carcinogenesis and progression of gastric cancer
21047978 ESFT that do not overexpress BMI-1 represent a novel subclass with a distinct molecular profile and altered activation of and dependence on cancer-associated biological pathways.
21039844 A direct correlation analysis showed that ubiquitin-specific protease 22 was strongly correlated with BMI-1 and c-Myc at the mRNA level.
20921134 BMI1 contributes to histone ubiquitylation and has a role in maintaining genomic stability.
20818602 High BMI1 is associated with lung adenocarcinoma.
20818389 Bmi1 and Twist1 act cooperatively to repress expression of both E-cadherin and p16INK4a.
20809956 Overexpression of Bmi-1 is associated with esophageal squamous cell carcinoma.
20724541 Introduction of BCR-ABL and BMI1 in human cord blood CD34+ cells induces lymphoid leukemia upon transplantation in NOD/SCID mice.
20717685 Our analysis showed correlation between BMI1 and PCGF2 gene's expression and survival in children with medulloblastoma.
20661663 knockdown of BMI-1 expression can induce cell-cycle arrest and up-regulate p16INK4a, HOXA9 and HOXC13 in HeLa cells
20592341 the BMI-I protein is significantly overexpressed in ovarian, endometrial and cervical cancer
20591222 Bmi-1 downregulation in esophageal carcinoma cells inhibits cell proliferation, cell cycle, and cell migration, while increasing cell apoptosis.
20574517 miR-128a has growth suppressive activity in medulloblastoma and that this activity is partially mediated by targeting Bmi-1.
20569464 data suggest that the PS domain of BMI1 is involved in its stability and that it negatively regulates function of BMI1 oncoprotein
20568112 Loss of BMI1 enhances docetaxel activity and impairs antioxidant response and promotes prostate cancer.
20564407 Bmi1 and EZH2 had characteristic and distinctive expression in NSCLCs.
20551323 the molecular mechanism of Bmi-1-mediated regulation of the p16 gene
20530672 Studies not only highlight Bmi-1 as a cancer-dependent factor in multiple myeloma, but also elucidate a novel antiapoptotic mechanism for Bmi-1 function involving the suppression of Bim.
20428793 BMI-1 depletion leads to reduced cell growth and proliferation, and increased cell apoptosis.
20426791 BMI1 plays an important role in the late progression of pancreatic cancer and may represent a therapeutic target for treatment of this cancer.
20385206 The study confirmed a direct involvement of Bmi-1 in the regulation of human fetal NSCs self-renewal and proliferation in vitro, and suggested that the Ink4a/Arf locus was a potential downstream target of Bmi-1 pathway.
20377880 Expression of Bmi-1 might be important in the acquisition of an invasive and/or aggressive phenotype of ovarian carcinoma, and serve as a independent biomarker for shortened survival time of patients.
20308890 Studies indicate that in the absence of BMI1, reactive oxygen species accumulate, associating with activation of DNA damage response pathways and increased apoptosis.
20190806 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20170541 BMI1 acts as an oncogene and Mel-18 functions as a tumor suppressor via downregulation of BMI1.
20145620 Negative Bmi-1 expression is associated with squamous cell carcinoma of the tongue.
20127006 EZH2 and BMI-1 are upregulated in osteosarcoma. EZH2 and BMI-1 may be useful targets for cancer immunotherapy of osteosarcoma, although knock-down of EZH2 and BMI-1 could not prevent osteosarcoma growth.
20085590 Bmi-1 gene is upregulated in early-stage hepatocellular carcinoma and correlates with ATP-binding cassette transporter B1 expression.
20035051 Bmi-1 bestows apoptotic resistance to glioma cells through the IKK-NF-kappaB pathway; Bmi-1 as a useful indicator for glioma prognosis.
20024662 The expression of Bmi-1 was elevated in colon cancer and might serve as an independent prognostic marker.
20015867 Although Bmi-1 does not influence the basal level of apoptotic activity, its overexpression protects the tumor cells against the proapoptotic action of (-)-epigallocatechin-3-gallate.
19957112 High Bmi1 is associated with colon cancer.
19956605 Silencing of Bmi1 inhibits drug-induced Top2alpha degradation, increases the persistence of Top2alpha-DNA cleavage complex, and increases Top2 drug efficacy.
19940551 Data show that tumor spheroid cells express ABCG2, Bmi1, WNT5A, CD133, prox1 and VEGFR3.
19934271 Bmi1 functions independent of Ink4A/Arf repression in liver cancer development.
19907431 key role of Bmi-1 downregulation in enforcing aging in primary human keratinocytes
19903841 Bmi-1 protein is downregulated by miR-15a or miR-16 expression and leads to significant reduction in ovarian cancer cell proliferation and clonal growth.
19903340 Nuclear PTEN reduces BMI1 function independently of its phosphatase activity.
19884659 upregulation of Bmi-1 induced epithelial-mesenchymal transition (EMT) and enhanced the motility and invasiveness of nasopharyngeal epithelial cells, whereas silencing endogenous Bmi-1 expression reversed EMT and reduced motility
19806792 Inhibition of Bmi-1 expression in human gastric carcinoma cells affects cell proliferation and invasiveness.
19778799 The overexpression of Bmi-1 protein was significantly correlated to the tumorigenesis, metastasis and prognosis of colorectal cancer.
19695678 The overexpression of polycomb-group protein Bmi1 is essential for colony formation and cell proliferation, probably by the repression of cellular senescence in intrahepatic cholangiocarcinoma.
19639171 Bmi-1 mRNA might be a new tool to support the diagnosis of breast cancers
19605626 BMI1 is expressed in human GBM tumors and highly enriched in CD133-positive cells. Stable BMI1 knockdown using short hairpin RNA-expressing lentiviruses resulted in inhibition of clonogenic potential in vitro and of brain tumor formation in vivo
19556423 BMI1 expression is required for maintenance and self-renewal of normal and leukemic stem and progenitor cells, and expression of BMI1 protects cells against oxidative stress.
19543317 BMI1 collaborates with H-RAS to induce an aggressive and metastatic phenotype with the unusual occurrence of brain metastasis.
19452584 Increased Bmi1 mRNA expression was significantly associated with esophageal squamous cell carcinoma progression, and the oncoprotein was largely distributed in the cytoplasm of tumor cells.
19389366 The more pronounced effects of Bmi-1 over-expression in culture were largely attributable to the attenuated induction of p16(Ink4a) and p19(Arf) in culture, proteins that are generally not expressed by neural stem/progenitor cells in young mice in vivo.
19386347 Distinct expression of BMI1 in hepatocellular carcinoma is reported.
19379548 Suppression of Bmi-1 expression is not able to reduce proliferation of K562 cells.
19337376 provides evidence that, in the appropriate context, expression of the SYT-SSX2 oncogene leads to loss of Bmi1 polycomb function
19269851 transcripotional control of Th2 memory cell generation
19233177 A polymorphism in Bmi-1 that reduces levels of this important protein.
19228380 Expression of Bmi-1 was greater in bladder cancers than in the adjacent normal tissues. Bmi-1 expression was positively correlated with tumor classification and TNM stage, but not with tumor number.
19099625 SALL4 and BMI-1 expressions are up-regulated significantly in acute leukemia.
19080003 Bmi-1 protein is highly expressed in bladder cancer.
19080002 Overexpression of Bmi-1 and Ki67 protein are significantly correlated with tumorigenesis, metastasis and prognosis of colorectal carcinoma.
19021148 dysregulated BMI-1 could indeed lead to keratinocytes transformation and tumorigenesis, potentially through promoting cell cycle progression and increasing cell mobility.
19012049 candidate for stem cell marker and renewal factor in nasal mucosa, may contribute to tissue homeostasis and differentiation in the epithelium and submucosal glands of normal nasal mucosa, and may play a role in proliferation of nasal polyps
18829528 An important role for BMI1 in the maintenance of tumor-initiating side population cells in hepatocellular carcinoma.
18817867 Data demonstrate that Bmi1 promotes prostate tumorigenesis, and that Bmi1 expression is associated with a reduction in tumor suppressors p16(INK4A) and p14(ARF).
18781299 inhibitors, BMI-1 is presumed to be positively regulated by BCR-ABL and further by posttranscriptional modification in the course of the disease progressio
18701473 Overexpresion of BMI-1 is associated with ewing sarcoma tumorigenesis
18668134 BMI1 overexpression accompanied with 11q23 rearrangements is associated with acute myeloid leukemias.
18592462 The relative expression of BMI1 in bladder tumor tissues is greater than 5 times that of nontumor samples and there is a statistically significant correlation between the level of BMI1 expression and the stage of the bladder tumors.
18591938 overexpression associated with the malignant progression of hepatocellular carcinoma
18565849 BMI-1 measured prior to allo-SCT can serve as a biomarker for predicting outcome in patients with CP-CML receiving allo-SCT
18475299 Loss of BMI-1 seems to be associated with an aggressive phenotype in endometrial carcinomas.
18450386 the results suggest that BMI1 does not play a significant prognosticator role ini astrocytic tumors
18439910 Bmi1 can induce multipotency in astrocytes.
18438345 Bmi-1 protein is highly expressed in ovarian epithelial cancer tissues, and its expression level correlates with histological grade and clinical phase of the patients.
18427816 BMI1 gene is aberrant at the chromosomal level in a subset of gliomas, and possibly contributes to brain tumour pathogenesis
18347933 study showed BMI-1 expression was inversely correlated with the differentiation grade of renal clear cell carcinoma; BMI-1 was strongly expressed in both papillary carcinomas and oncocytomas
18346113 BMI-1 is a novel independent prognostic marker in oligodendroglial tumours.
18269588 Neither EGFR nor BMI-1 had significant prognostic impact for basal-like phenotype of breast cancer.
18264721 Bmi-1 expression in non-small cell lung cancer (NSCLC) in respect to clinicopathological features and therapeutic outcomes
18246051 loss of BMI-1 expression was associated with features of aggressive tumors. Low levels of BMI-1 expression were also significantly associated with decreased patient survival.
18228133 Bmi-1 expression associated with favorable overall survival only in estrogen receptor-positive breast cancer patients.
18156489 BMI1 is an intrinsic regulator of human stem/progenitor cell self-renewal.
18094618 BMI-1 antibody as a potential marker of nasopharyngeal carcinoma may be rational, and could have diagnostic and prognostic value.
17989714 BMI1 is an oncogenic candidate in a novel TCRB-associated chromosomal aberration in a patient with TCRgammadelta+ T-cell acute lymphoblastic leukemia
17974970 Examination of various growth-regulatory pathways suggested that Bmi-1 overexpression together with H-Ras promotes human mammary epithelial cell transformation and breast oncogenesis by deregulation of multiple growth-regulatory pathways.
17917742 Bmi-1 could be a candidate biomarker for long-term survival in HCC
17711569 Elevated Bmi-1 is associated with breast cancer
17666329 Bmi-1 mRNA expression is correlated to differentiation and metastasis of gastric carcinoma and may facilitate its prognostic evaluation.
17625597 Bmi-1 may promote maintenance of suprabasal keratinocyte survival to prevent premature death during differentiation.
17597110 BMI-1 mediated repression of p16(ink4a) may contribute to an increased aggressive behavior of stem cell-like melanoma cells.
17557835 BMI1 is a target gene for SALL4 in leukemic cells.
17545584 Mel-18 and Bmi-1 may regulate the Akt pathway in breast cancer cells, and that Mel-18 functions as a tumor suppressor by repressing the expression of Bmi-1 and consequently down-regulating Akt activity.
17454639 Bmi-1 seems to play a secondary role in chronic myeloid leukemia transformation
17452456 These results suggest that Bmi-1 and Mel-18 may have overlapping functions in cancer cell growth.
17360938 In a cohort of 64 CML patients, the level of BMI1 at diagnosis correlated with time to transformation to blast crisis, and the combination of low BMI1 and high proteinase-3 expression was associated with an improved overall survival
17344414 Study shows that the ability of the oncogene BMI1 to repress the INK4A-ARF locus requires its direct association and is dependent on the continued presence of the EZH2-containing Polycomb-Repressive Complex 2 complex.
17298744 The intensive expression of Bmi-1 in breast cancer is related to tumor progression.
17233832 many human cell types undergo senescence by activation of the p16(INK4a)/Rb pathway, and that introduction of Bmi-1 can inhibit p16(INK4a) expression and extend the life span of human epithelial cells
17179983 The Bmi-1 may act through p16(INK4A)-independent pathways to regulate cellular proliferation during oral cancer progression.
17161394 Our results provide new information on the roles of Bmi-1 and HPV-16 E6 in the multi-step process of oral epithelial carcinogenesis.
17151361 Our data suggest that Mel-18 regulates Bmi-1 expression during senescence via down-regulation of c-Myc.
17148591 Bmi-1 and LMP1 down-regulate the ataxia telangiectasia-mutated (ATM) tumor suppressor and conclude that Bmi-1 contributes to LMP1-induced oncogenesis in Hodgkin lymphoma
17148583 ERK5 probably mediates HOXB9 expression by repressing BMI1 in Hodgkin lymphoma cell lines
17145814 Bmi1 overexpression was correlated with the malignant grades of human digestive precancerous tissues, which suggests that advanced Bmi1 dysregulation might predict malignant progression.
17145810 The oncogenic role of Bmi-1 in human primary breast carcinomas is not determined by its capacity to inhibit INK4a/ARF proteins(p16INK4a, p14ARF, or h-TERT) or to induce telomerase activity.
17134822 PcG protein BMI1 is associated with adverse pathological features and clinical PSA recurrence of prostate cancer.
16982619 Bmi-1 regulates the differentiation and clonogenic self-renewal of I-type neuroblastoma cells
16963837 Advanced cell- & animal imaging, expression profiling, stable siRNA-gene targeting, and TMAs of experimental and clinical samples indicate that activation of the BMI1 oncogene-associated PcG pathway plays an essential role in metastatic prostate cancer.
16936260 bmi1 expression caused by oxidative stress may be involved in the pathogenesis of cellular senescence of biliary epithelial cells in primary biliary cirrhosis.
16874656 BMI-1 is expressed in gastrointestinal stem cells and may have a role protein in cellular differentiation and stem cell maintenance
16751658 Bmi1 is required for H2A ubiquitylation; H2A ubiquitylation regulates Bmi1-mediated gene expression
16714294 Bmi-1-Ring1B complex stabilizes the interaction of the ubiquitin ligase complex.
16537449 p16(INK4a) expression was regulated by the Polycomb group repressor Bmi-1, which is shown as a direct transcriptional target of c-Myc.
16501599 Critical for the short-term survival of cancer cells, and inhibition has minimal effect on the survival of normal cells.
16314526 EZH2 is essential for BMI1 recruitment to the polycomb bodies.
16107895 CALM-AF10+ T-ALL associatd with elevated expression of subset of HOXA genes and some of there transcriptional and functional regulators, as well as specific overexpression of oncogene BMI1
16105758 a subgroup of M0 patients has a high expression level of polycomb group gene BMI-1, which may contribute to leukemogenesis
15931389 Altered expression is associated with therapy failure and death in patients with multiple types of cancer.
15563468 Activation or overexpression of MAPKAP kinase 3pK resulted in phosphorylation of Bmi1 and other PcG members and their dissociation from chromatin
15029199 BMI1 overexpression is an alternative or additive mechanism in the pathogenesis of medulloblastomas
15009096 BMI-1 is transiently localized with the centromeric region in interphase.
14732230 modulation of Bmi-1 protein might be involved in human colorectal carcinogenesis by repressing the INK4a/ARF proteins
14536079 E2a-Pbx1 and Bmi-1 are likely to play a role in the pathogenesis of human lymphoid leukemias through downregulation of the INK4A-ARF gene
12829790 BMI-1 binds the MLL repression domain. Recruitment of BMI-1 to the MLL protein may be able to modulate its function.
12482990 Bmi-1 extends the replicative life span of human fibroblasts by suppressing the p16-dependent senescence pathway
12183433 The Bmi-1 oncogene induces telomerase activity and immortalizes human mammary epithelial cells.

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR      1 - 70
SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQ     71 - 140
NRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIA    141 - 210
YIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ    211 - 280
SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG                            281 - 326
//

Text Mined References (361)

PMID Year Title
26935956 2016 Targeting of BMI-1 with PTC-209 shows potent anti-myeloma activity and impairs the tumour microenvironment.
26763885 2016 BMI1 Regulation of Self-Renewal and Multipotency in Human Mesenchymal Stem Cells.
26690524 2015 CD133 and BMI1 expressions and its prognostic role in primary glioblastoma.
26679841 2016 BMI1 induces an invasive signature in melanoma that promotes metastasis and chemoresistance.
26633535 2015 A Novel Aspect of Tumorigenesis-BMI1 Functions in Regulating DNA Damage Response.
26623561 2016 The BMI1 inhibitor PTC-209 is a potential compound to halt cellular growth in biliary tract cancer cells.
26578590 2016 RING1A and BMI1 bookmark active genes via ubiquitination of chromatin-associated proteins.
26573774 2016 Downregulation of Bmi-1 is associated with suppressed tumorigenesis and induced apoptosis in CD44? nasopharyngeal carcinoma cancer stem-like cells.
26573508 2016 Mitogen-activated protein kinase kinase 3 induces cell cycle arrest via p38 activation mediated Bmi-1 downregulation in hepatocellular carcinoma.
26517683 2015 A Polycomb-mir200 loop regulates clinical outcome in bladder cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26489630 2015 Knockdown of Bmi1 inhibits bladder cancer cell growth both in vitro and in vivo by blocking cell cycle at G1 phase and inducing apoptosis.
26468281 2016 The Polycomb Repressive Complex 1 Protein BMI1 Is Required for Constitutive Heterochromatin Formation and Silencing in Mammalian Somatic Cells.
26452029 2015 Hes1 promotes cell proliferation and migration by activating Bmi-1 and PTEN/Akt/GSK3? pathway in human colon cancer.
26343356 2015 Polycomb genes are associated with response to imatinib in chronic myeloid leukemia.
26316085 2015 Up-Regulation of MiR-452 Inhibits Metastasis of Non-Small Cell Lung Cancer by Regulating BMI1.
26261549 2015 Effects of targeted nano-delivery systems combined with hTERT-siRNA and Bmi-1-siRNA on MCF-7 cells.
26238021 2015 MicroRNA?128a, BMI1 polycomb ring finger oncogene, and reactive oxygen species inhibit the growth of U?87 MG glioblastoma cells following exposure to X?ray radiation.
26202447 2015 Hypoxia promotes vasculogenic mimicry formation by the Twist1-Bmi1 connection in hepatocellular carcinoma.
26191215 2015 Rapamycin, a mTOR inhibitor, induced growth inhibition in retinoblastoma Y79 cell via down-regulation of Bmi-1.
26151332 2015 BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
26110620 2015 BMI1 is expressed in canine osteosarcoma and contributes to cell growth and chemotherapy resistance.
26090866 2015 Activation of microRNA-494-targeting Bmi1 and ADAM10 by silibinin ablates cancer stemness and predicts favourable prognostic value in head and neck squamous cell carcinomas.
26081615 2015 Bmi-1 is essential for the oncogenic potential in CD133(+) human laryngeal cancer cells.
26043676 2015 Expression of BMI1 and ZEB1 in epithelial-mesenchymal transition of tongue squamous cell carcinoma.
26023734 2015 ER? inhibits epithelial-mesenchymal transition by suppressing Bmi1 in breast cancer.
25968877 2016 Prognostic Value and Clinicopathological Differences of Bmi1 in Gastric Cancer: A Meta-analysis.
25967457 2015 MicroRNA-218 inhibits bladder cancer cell proliferation, migration, and invasion by targeting BMI-1.
25967455 2015 High peritumoral Bmi-1 expression is an independent prognosticator of poor prognosis in renal cell carcinoma.
25922517 2015 MOZ and BMI1 play opposing roles during Hox gene activation in ES cells and in body segment identity specification in vivo.
25915207 2015 Bmi1 essentially mediates podocalyxin-enhanced Cisplatin chemoresistance in oral tongue squamous cell carcinoma.
25903073 2015 miR-200c/Bmi1 axis and epithelial-mesenchymal transition contribute to acquired resistance to BRAF inhibitor treatment.
25899063 2015 NANOG signaling promotes metastatic capability of immunoedited tumor cells.
25880371 2015 Bmi-1 expression modulates non-small cell lung cancer progression.
25858624 2015 Silencing of Bmi-1 gene enhances chemotherapy sensitivity in human glioblastoma cells.
25853770 2015 MK3 modulation affects BMI1-dependent and independent cell cycle check-points.
25843776 2015 The Bmi-1 helix-turn and ring finger domains are required for Bmi-1 antagonism of (-) epigallocatechin-3-gallate suppression of skin cancer cell survival.
25775580 2015 The CDX1-microRNA-215 axis regulates colorectal cancer stem cell differentiation.
25761682 2015 Downregulation of miR-221, -30d, and -15a contributes to pathogenesis of prostate cancer by targeting Bmi-1.
25751743 2015 Bmi1 limits dilated cardiomyopathy and heart failure by inhibiting cardiac senescence.
25737447 2015 MicroRNA-31 is a transcriptional target of histone deacetylase inhibitors and a regulator of cellular senescence.
25726526 2015 Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.
25663545 2015 The role of polycomb group protein Bmi-1 and Notch4 in breast cancer stem cell inhibition by benzyl isothiocyanate.
25552924 2015 Bmi1 drives stem-like properties and is associated with migration, invasion, and poor prognosis in tongue squamous cell carcinoma.
25547677 2015 Direct serum assay for cell-free bmi-1 mRNA and its potential diagnostic and prognostic value for colorectal cancer.
25526772 2014 Silencing BMI1 eliminates tumor formation of pediatric glioma CD133+ cells not by affecting known targets but by down-regulating a novel set of core genes.
25505268 2015 PLK1 inhibition down-regulates polycomb group protein BMI1 via modulation of the miR-200c/141 cluster.
25501509 2015 Polygala tenuifolia polysaccharide (PTP) inhibits cell proliferation by repressing Bmi-1 expression and downregulating telomerase activity.
25475727 2015 MiR-203 inhibits melanoma invasive and proliferative abilities by targeting the polycomb group gene BMI1.
25458792 2014 Prognostic role of high Bmi-1 expression in Asian and Caucasian patients with solid tumors: a meta-analysis.
25451922 2015 BRCA1-associated protein 1 (BAP1) deubiquitinase antagonizes the ubiquitin-mediated activation of FoxK2 target genes.
25416956 2014 A proteome-scale map of the human interactome network.
25385494 2015 Bmi1 promotes erythroid development through regulating ribosome biogenesis.
25367080 2014 miR-200c inhibits invasion, migration and proliferation of bladder cancer cells through down-regulation of BMI-1 and E2F3.
25348805 2014 Bmi1 regulates self-renewal and epithelial to mesenchymal transition in breast cancer cells through Nanog.
25333742 2014 Ethyl acetate extract from Jiedu Xiaozheng Yin inhibits the proliferation of human hepatocellular carcinoma cells by suppressing polycomb gene product Bmi1 and Wnt/?-catenin signaling.
25286028 2014 Oncogenic roles of Bmi1 and its therapeutic inhibition by histone deacetylase inhibitor in tongue cancer.
25262972 2015 Bmi-1 regulates the migration and invasion of glioma cells through p16.
25252846 2014 A novel NF-?B/MMP-3 signal pathway involves in the aggressivity of glioma promoted by Bmi-1.
25243792 2014 Prognostic value of polycomb proteins EZH2, BMI1 and SUZ12 and histone modification H3K27me3 in colorectal cancer.
25241082 2015 Clinical implications of BMI-1 in cancer stem cells of laryngeal carcinoma.
25185265 2014 UBAP2L is a novel BMI1-interacting protein essential for hematopoietic stem cell activity.
25148045 2014 A retrospective review of the prognostic value of ALDH-1, Bmi-1 and Nanog stem cell markers in esophageal squamous cell carcinoma.
25131797 2015 p21/Cyclin E pathway modulates anticlastogenic function of Bmi-1 in cancer cells.
25110121 2014 Prognostic significance of miR-218 in human hepatocellular carcinoma and its role in cell growth.
25109303 2014 MicroRNA-183 is involved in cell proliferation, survival and poor prognosis in pancreatic ductal adenocarcinoma by regulating Bmi-1.
25088203 2015 BMI1 attenuates etoposide-induced G2/M checkpoints via reducing ATM activation.
25084695 2014 BMI1 gene expression in myeloid leukemias and its impact on prognosis.
25031724 2014 Bmi-1 regulates epithelial-to-mesenchymal transition to promote migration and invasion of breast cancer cells.
25013381 2014 MicroRNA-135a inhibits cell proliferation by targeting Bmi1 in pancreatic ductal adenocarcinoma.
25009285 2014 Hypoxia-induced Bmi1 promotes renal tubular epithelial cell-mesenchymal transition and renal fibrosis via PI3K/Akt signal.
24927072 2014 ShRNA targeting Bmi-1 sensitizes CD44? nasopharyngeal cancer stem-like cells to radiotherapy.
24915841 2014 Bmi-1 plays a critical role in protection from renal tubulointerstitial injury by maintaining redox balance.
24913180 2014 ShRNA-mediated Bmi-1 silencing sensitizes multiple myeloma cells to bortezomib.
24909638 2014 Effect of Twist and Bmi1 on intraductal papillary mucinous neoplasm of the pancreas.
24889242 2014 Adenovirus assembly is impaired by BMI1-related histone deacetylase activity.
24870796 2014 BMI1 and TWIST1 downregulated mRNA expression in basal cell carcinoma.
24839010 2014 Expression patterns of microRNA-218 and its potential functions by targeting CIP2A and BMI1 genes in melanoma.
24833884 2014 Expression of Bmi-1 and PAI-1 in esophageal squamous cell carcinoma.
24800958 2014 The role of BMI1 as a biomarker of cancer stem cells in head and neck cancer: a review.
24719948 Elevated expression of Bmi1 in hepatocellular carcinoma with bile duct tumor thrombi.
24709421 2014 Cisplatin induces Bmi-1 and enhances the stem cell fraction in head and neck cancer.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
24614341 2014 Ubiquitination and degradation of ribonucleotide reductase M1 by the polycomb group proteins RNF2 and Bmi1 and cellular response to gemcitabine.
24571310 2014 BMI1 reprogrammes histone acetylation and enhances c-fos pathway via directly binding to Zmym3 in malignant myeloid progression.
24559156 2014 Estrogen receptor ?-coupled Bmi1 regulation pathway in breast cancer and its clinical implications.
24460684 2014 Polycomb group gene BMI1 controls invasion of medulloblastoma cells and inhibits BMP-regulated cell adhesion.
24415717 2014 Expression of ABCG2 and Bmi-1 in oral potentially malignant lesions and oral squamous cell carcinoma.
24393364 2014 Expression of B-cell-specific Moloney murine leukemia virus integration site 1 mRNA and protein in gastric cancer.
24379598 2013 Silencing Bmi-1 enhances the senescence and decreases the metastasis of human gastric cancer cells.
24342665 2014 Immunohistochemical expression and prognostic relevance of Bmi-1, a stem cell factor, in epithelial ovarian cancer.
24337040 2014 Knockdown of Bmi1 inhibits the stemness properties and tumorigenicity of human bladder cancer stem cell-like side population cells.
24317363 2014 miR-200b suppresses cell proliferation, migration and enhances chemosensitivity in prostate cancer by regulating Bmi-1.
24312366 2013 Identification of miR-30e* regulation of Bmi1 expression mediated by tumor-associated macrophages in gastrointestinal cancer.
24300467 2014 Molecular portraits of heterogeneity related to cancer stem cells in human ovarian cancer.
24292392 2014 Self-renewal as a therapeutic target in human colorectal cancer.
24252251 2014 miR-15a inhibits cell proliferation and epithelial to mesenchymal transition in pancreatic ductal adenocarcinoma by down-regulating Bmi-1 expression.
24219349 2014 miR-203 inhibits the proliferation and self-renewal of esophageal cancer stem-like cells by suppressing stem renewal factor Bmi-1.
24145240 2013 Stem cell self-renewal factors Bmi1 and HMGA2 in head and neck squamous cell carcinoma: clues for diagnosis.
24139839 2013 Combined aberrant expression of Bmi1 and EZH2 is predictive of poor prognosis in glioma patients.
24122997 2013 Aberrant expression of EZH2 is associated with pathological findings and P53 alteration.
24039897 2013 A Bmi1-miRNAs cross-talk modulates chemotherapy response to 5-fluorouracil in breast cancer cells.
23990442 2014 IGF-1R and Bmi-1 expressions in lung adenocarcinoma and their clinicopathologic and prognostic significance.
23984324 2013 Expression of bmi-1 in pediatric brain tumors as a new independent prognostic marker of patient survival.
23950210 2013 MicroRNA-218 inhibits glioma invasion, migration, proliferation, and cancer stem-like cell self-renewal by targeting the polycomb group gene Bmi1.
23873701 2013 BMI1, the polycomb-group gene, is recurrently targeted by genomic rearrangements in progressive B-cell leukemia/lymphoma.
23873108 2013 Regulation of BMI1 Polycomb gene expression in histological grades of invasive ductal breast carcinomas and its correlation with hormone receptor status.
23864317 2013 Expression of Bmi1, FoxF1, Nanog, and ?-catenin in relation to hedgehog signaling pathway in human non-small-cell lung cancer.
23820733 2013 Knockdown BMI1 expression inhibits proliferation and invasion in human bladder cancer T24 cells.
23807724 2013 Overexpression of Bmi-1 contributes to the invasion and metastasis of hepatocellular carcinoma by increasing the expression of matrix metalloproteinase (MMP)?2, MMP-9 and vascular endothelial growth factor via the PTEN/PI3K/Akt pathway.
23744494 2013 Novel childhood ALL susceptibility locus BMI1-PIP4K2A is specifically associated with the hyperdiploid subtype.
23727134 2013 The dynamics of polycomb group proteins in early embryonic nervous system in mouse and human.
23712029 2013 BMI-1 activation is crucial in hTERT-induced epithelial-mesenchymal transition of oral epithelial cells.
23708658 2014 Phosphorylation of Nanog is essential to regulate Bmi1 and promote tumorigenesis.
23700898 Expression of bmi-1 protein in cervical, breast and ovarian cancer.
23686310 2014 Dysregulation of BMI1 and microRNA-16 collaborate to enhance an anti-apoptotic potential in the side population of refractory mantle cell lymphoma.
23671559 2013 BMI1 polycomb group protein acts as a master switch for growth and death of tumor cells: regulates TCF4-transcriptional factor-induced BCL2 signaling.
23601184 2013 Sp1 and c-Myc regulate transcription of BMI1 in nasopharyngeal carcinoma.
23592496 2013 FoxG1 interacts with Bmi1 to regulate self-renewal and tumorigenicity of medulloblastoma stem cells.
23559850 2013 Role of B lymphoma Mo-MLV insertion region 1 in the oncogenic behavior of retinoblastomas.
23525303 2013 Silencing Bmi-1 expression by RNA interference suppresses the growth of laryngeal carcinoma cells.
23468063 2013 Copper induces cellular senescence in human glioblastoma multiforme cells through downregulation of Bmi-1.
23437065 2013 Bmi1 enhances tumorigenicity and cancer stem cell function in pancreatic adenocarcinoma.
23383216 2013 Bmi-1 promotes glioma angiogenesis by activating NF-?B signaling.
23308129 2013 BMI1, stem cell factor acting as novel serum-biomarker for Caucasian and African-American prostate cancer.
23255074 2013 MicroRNA-218 inhibits cell cycle progression and promotes apoptosis in colon cancer by downregulating BMI1 polycomb ring finger oncogene.
23242307 2013 Bmi1 gene silencing inhibits the proliferation and invasiveness of human hepatocellular carcinoma cells and increases their sensitivity to 5-fluorouracil.
23239878 2013 A positive feedback loop regulates the expression of polycomb group protein BMI1 via WNT signaling pathway.
23204235 2013 Chromosome instability modulated by BMI1-AURKA signaling drives progression in head and neck cancer.
23138990 2013 Bmi1 knockdown inhibits hepatocarcinogenesis.
23092893 2012 Akt phosphorylates the transcriptional repressor bmi1 to block its effects on the tumor-suppressing ink4a-arf locus.
23078618 2012 Clinicopathologic characteristics of high expression of Bmi-1 in esophageal adenocarcinoma and squamous cell carcinoma.
23057360 2012 [Expressions of B-cell-specific monoclonal leukemia virus insert site 1 and human telomerase reverse transcriptase genes in CD34+ cells during ex vivo expansion process].
23046527 2012 The oncoprotein and stem cell renewal factor BMI1 associates with poor clinical outcome in oesophageal cancer patients undergoing preoperative chemoradiotherapy.
23023333 2012 CHMP1A encodes an essential regulator of BMI1-INK4A in cerebellar development.
22994774 2012 The clinicopathological significance of Bmi-1 expression in pathogenesis and progression of gastric carcinomas.
22982443 2012 miR-200c inhibits melanoma progression and drug resistance through down-regulation of BMI-1.
22967049 2012 Bmi-1 promotes the aggressiveness of glioma via activating the NF-kappaB/MMP-9 signaling pathway.
22912356 2012 Prognostic relevance of c-Myc and BMI1 expression in patients with glioblastoma.
22898137 2012 Overexpression of BMI-1 is associated with poor prognosis in cervical cancer.
22897849 2012 ASXL1 mutations promote myeloid transformation through loss of PRC2-mediated gene repression.
22872929 2012 Bmi-1 siRNA inhibited ovarian cancer cell line growth and decreased telomerase activity.
22863087 2013 Coexpression of B-lymphoma Moloney murine leukemia virus insertion region-1 and sex-determining region of Y chromosome-related high mobility group box-2 in cervical carcinogenesis.
22842564 2012 Bmi-1 confers adaptive radioresistance to KYSE-150R esophageal carcinoma cells.
22825250 2012 Alterations of polycomb gene BMI1 in human myeloproliferative neoplasms.
22777769 2012 VEGF/neuropilin-2 regulation of Bmi-1 and consequent repression of IGF-IR define a novel mechanism of aggressive prostate cancer.
22766604 2012 Co-expression of Bmi1 and EZH2 as an independent poor prognostic factor in esophageal squamous cell carcinoma.
22725270 2013 Expression of cancer stem cell markers ALDH1 and Bmi1 in oral erythroplakia and the risk of oral cancer.
22664532 2012 shRNA targeting Bmi1 impedes the self-renewal of cisplatin-enriched stem-like cells in human A549 cells.
22509111 2012 High expression of p16INK4a and low expression of Bmi1 are associated with endothelial cellular senescence in the human cornea.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22420951 2012 shRNA-mediated knockdown of Bmi-1 inhibit lung adenocarcinoma cell migration and metastasis.
22384090 2012 Bmi1 is down-regulated in the aging brain and displays antioxidant and protective activities in neurons.
22366984 2012 Cancer stem cell marker Bmi-1 expression is associated with basal-like phenotype and poor survival in breast cancer.
22293918 2012 Bmi-1 regulates autoreactive CD4+ T cell survival in immune thrombocytopenia patients.
22265735 2012 Bmi1 marks intermediate precursors during differentiation of human brain tumor initiating cells.
22252887 2012 Role of BMI1, a stem cell factor, in cancer recurrence and chemoresistance: preclinical and clinical evidences.
22209830 2012 Bmi-1 induces radioresistance in MCF-7 mammary carcinoma cells.
22170051 2012 Regulation of the potential marker for intestinal cells, Bmi1, by ?-catenin and the zinc finger protein KLF4: implications for colon cancer.
22132147 2011 BMI-1 autoantibody as a new potential biomarker for cervical carcinoma.
22120721 2012 Cyclin E1 is a common target of BMI1 and MYCN and a prognostic marker for neuroblastoma progression.
22120066 2012 Overexpression of BMI1 confers clonal cells resistance to apoptosis and contributes to adverse prognosis in myelodysplastic syndrome.
22096526 2011 Bmi1 is expressed in postnatal myogenic satellite cells, controls their maintenance and plays an essential role in repeated muscle regeneration.
22078878 2011 ncRNA- and Pc2 methylation-dependent gene relocation between nuclear structures mediates gene activation programs.
22040961 2011 [Clinical significance of leukemia stem/progenitor cell related gene expression in acute leukemia].
22009787 2012 Two stem cell markers, ATP-binding cassette, G2 subfamily (ABCG2) and BMI-1, predict the transformation of oral leukoplakia to cancer: a long-term follow-up study.
21999765 2012 Overexpression of BMI-1 correlates with drug resistance in B-cell lymphoma cells through the stabilization of survivin expression.
21960247 2012 c-Myb and its target Bmi1 are required for p190BCR/ABL leukemogenesis in mouse and human cells.
21919891 2011 Epithelial-mesenchymal transition and cancer stemness: the Twist1-Bmi1 connection.
21883379 2012 Linkage between Twist1 and Bmi1: molecular mechanism of cancer metastasis/stemness and clinical implications.
21866458 2011 [Mechanism of polycomb Bmi1-targeted therapy for colorectal cancer].
21865393 2011 Evidence for alteration of EZH2, BMI1, and KDM6A and epigenetic reprogramming in human papillomavirus type 16 E6/E7-expressing keratinocytes.
21856782 2011 MYCN and MYC regulate tumor proliferation and tumorigenesis directly through BMI1 in human neuroblastomas.
21851624 2011 MicroRNA-194 inhibits epithelial to mesenchymal transition of endometrial cancer cells by targeting oncogene BMI-1.
21772249 2011 Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
21755556 2011 BMI1'S maintenance of the proliferative capacity of laryngeal cancer stem cells.
21735131 2011 The co-expression of USP22 and BMI-1 may promote cancer progression and predict therapy failure in gastric carcinoma.
21732356 2012 Acetylation-dependent nuclear arrangement and recruitment of BMI1 protein to UV-damaged chromatin.
21725369 2012 MiR-200b and miR-15b regulate chemotherapy-induced epithelial-mesenchymal transition in human tongue cancer cells by targeting BMI1.
21685941 2012 Sonic hedgehog regulates Bmi1 in human medulloblastoma brain tumor-initiating cells.
21678481 2011 BMI1 as a novel target for drug discovery in cancer.
21656027 2012 The relationship between Bmi-1 and the epithelial-mesenchymal transition in lung squamous cell carcinoma.
21638011 2011 Bmi-1, c-myc, and Snail expression in primary breast cancers and their metastases--elevated Bmi-1 expression in late breast cancer relapses.
21572997 2011 DNA methyltransferase controls stem cell aging by regulating BMI1 and EZH2 through microRNAs.
21496667 2011 Impaired odontogenic differentiation of senescent dental mesenchymal stem cells is associated with loss of Bmi-1 expression.
21430439 2011 ?TrCP regulates BMI1 protein turnover via ubiquitination and degradation.
21428211 2011 Silencing of Bmi-1 gene by RNA interference enhances sensitivity to doxorubicin in breast cancer cells.
21383063 2011 BMI1 is recruited to DNA breaks and contributes to DNA damage-induced H2A ubiquitination and repair.
21373837 2011 In search of CML stem cells' deadly weakness.
21370603 2010 Overexpression of Bmi-1 in uterine cervical cancer: correlation with clinicopathology and prognosis.
21309753 2011 Clinicopathological and prognostic significance of Bmi-1 expression in human cervical cancer.
21307872 2011 Radioprotective effects of Bmi-1 involve epigenetic silencing of oxidase genes and enhanced DNA repair in normal human keratinocytes.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21276221 2011 Bmi-1 promotes invasion and metastasis, and its elevated expression is correlated with an advanced stage of breast cancer.
21276135 2011 Bmi1 regulates cell fate via tumor suppressor WWOX repression in small-cell lung cancer cells.
21259057 2012 Association of ?-catenin, Wnt1, Smad4, Hoxa9, and Bmi-1 with the prognosis of esophageal squamous cell carcinoma.
21252986 2011 Improved outcome following allogeneic stem cell transplantation in chronic myeloid leukemia is associated with higher expression of BMI-1 and immune responses to BMI-1 protein.
21170084 2011 BMI-1 suppresses contact inhibition and stabilizes YAP in Ewing sarcoma.
21164364 2011 p16Ink4a suppression of lung adenocarcinoma by Bmi-1 in the presence of p38 activation.
21162745 2010 Expression of BMI-1 and Mel-18 in breast tissue--a diagnostic marker in patients with breast cancer.
21152871 2011 Knockdown of the Bmi-1 oncogene inhibits cell proliferation and induces cell apoptosis and is involved in the decrease of Akt phosphorylation in the human breast carcinoma cell line MCF-7.
21125401 2011 Overexpression of the EZH2, RING1 and BMI1 genes is common in myelodysplastic syndromes: relation to adverse epigenetic alteration and poor prognostic scoring.
21113618 2011 Stem cell-related proteins C-KIT, C-MYC and BMI-1 in juvenile nasopharyngeal angiofibroma--do they have a role?
21059209 2010 Expression and clinicopathological significance of Mel-18 and Bmi-1 mRNA in gastric carcinoma.
21047978 2011 Ewing tumors that do not overexpress BMI-1 are a distinct molecular subclass with variant biology: a report from the Children's Oncology Group.
21039844 2010 Increased expression of ubiquitin-specific protease 22 can promote cancer progression and predict therapy failure in human colorectal cancer.
20921134 2010 BMI1-mediated histone ubiquitylation promotes DNA double-strand break repair.
20818602 2010 The expression of stem cell-related indicators as a prognostic factor in human lung adenocarcinoma.
20818389 2010 Bmi1 is essential in Twist1-induced epithelial-mesenchymal transition.
20809956 2010 Prognostic relevance of Bmi-1 expression and autoantibodies in esophageal squamous cell carcinoma.
20724541 2010 BMI1 collaborates with BCR-ABL in leukemic transformation of human CD34+ cells.
20717685 2011 Polycomb genes expression as a predictor of poor clinical outcome in children with medulloblastoma.
20661663 2011 Knockdown of BMI-1 causes cell-cycle arrest and derepresses p16INK4a, HOXA9 and HOXC13 mRNA expression in HeLa cells.
20601937 2010 Ubiquitin-specific proteases 7 and 11 modulate Polycomb regulation of the INK4a tumour suppressor.
20592341 2010 Overexpression of polycomb protein BMI-1 in human specimens of breast, ovarian, endometrial and cervical cancer.
20591222 2010 Expression of Bmi-1 gene in esophageal carcinoma cell EC9706 and its effect on cell cycle, apoptosis and migration.
20574517 2010 MicroRNA 128a increases intracellular ROS level by targeting Bmi-1 and inhibits medulloblastoma cancer cell growth by promoting senescence.
20569464 2010 Deletion analysis of BMI1 oncoprotein identifies its negative regulatory domain.
20568112 2011 BMI1 silencing enhances docetaxel activity and impairs antioxidant response in prostate cancer.
20564407 2010 Distinctive expression of the polycomb group proteins Bmi1 polycomb ring finger oncogene and enhancer of zeste homolog 2 in nonsmall cell lung cancers and their clinical and clinicopathologic significance.
20551323 2010 Identification and characterization of Bmi-1-responding element within the human p16 promoter.
20530672 2010 The Polycomb group protein Bmi-1 is essential for the growth of multiple myeloma cells.
20428793 2010 Anti-proliferation effect of BMI-1 in U937 cells with siRNA.
20426791 2010 Bmi-1 is related to proliferation, survival and poor prognosis in pancreatic cancer.
20385206 2010 Bmi-1 regulates self-renewal, proliferation and senescence of human fetal neural stem cells in vitro.
20377880 2010 Intensive expression of Bmi-1 is a new independent predictor of poor outcome in patients with ovarian carcinoma.
20308890 2010 Role of the polycomb group gene BMI1 in normal and leukemic hematopoietic stem and progenitor cells.
20190806 2010 Bmi1 is a MYCN target gene that regulates tumorigenesis through repression of KIF1Bbeta and TSLC1 in neuroblastoma.
20170541 2010 BMI1 and Mel-18 oppositely regulate carcinogenesis and progression of gastric cancer.
20145620 2010 Bmi-1 expression predicts prognosis in squamous cell carcinoma of the tongue.
20127006 2010 The knock-down of overexpressed EZH2 and BMI-1 does not prevent osteosarcoma growth.
20085590 2010 Bmi-1 gene is upregulated in early-stage hepatocellular carcinoma and correlates with ATP-binding cassette transporter B1 expression.
20035051 2010 Oncoprotein Bmi-1 renders apoptotic resistance to glioma cells through activation of the IKK-nuclear factor-kappaB Pathway.
20024662 2010 Expression level of Bmi-1 oncoprotein is associated with progression and prognosis in colon cancer.
20015867 2010 The Bmi-1 polycomb protein antagonizes the (-)-epigallocatechin-3-gallate-dependent suppression of skin cancer cell survival.
19957112 2010 Polycomb group protein Bmi1 expression in colon cancers predicts the survival.
19956605 2009 The E3 ubiquitin-ligase Bmi1/Ring1A controls the proteasomal degradation of Top2alpha cleavage complex - a potentially new drug target.
19940551 2009 Isolation and characterization of spheroid cells from human malignant melanoma cell line WM-266-4.
19934271 2009 Bmi1 functions as an oncogene independent of Ink4A/Arf repression in hepatic carcinogenesis.
19907431 2010 Bmi-1 reduction plays a key role in physiological and premature aging of primary human keratinocytes.
19903841 2009 MiR-15a and MiR-16 control Bmi-1 expression in ovarian cancer.
19903340 2009 PTEN inhibits BMI1 function independently of its phosphatase activity.
19884659 2009 The polycomb group protein Bmi-1 represses the tumor suppressor PTEN and induces epithelial-mesenchymal transition in human nasopharyngeal epithelial cells.
19806792 2009 Knockdown of Bmi-1 impairs growth and invasiveness of human gastric carcinoma cells.
19778799 2009 [Association of Bmi-1 expression with clinicopathological features and prognosis of colorectal cancer].
19695678 2009 Polycomb group protein Bmi1 is overexpressed and essential in anchorage-independent colony formation, cell proliferation and repression of cellular senescence in cholangiocarcinoma: tissue and culture studies.
19639171 2009 Diagnostic importance of overexpression of Bmi-1 mRNA in early breast cancers.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
19605626 2009 BMI1 sustains human glioblastoma multiforme stem cell renewal.
19556423 2009 Repression of BMI1 in normal and leukemic human CD34(+) cells impairs self-renewal and induces apoptosis.
19543317 2009 BMI1 cooperates with H-RAS to induce an aggressive breast cancer phenotype with brain metastases.
19452584 2009 Association between Bmi1 and clinicopathological status of esophageal squamous cell carcinoma.
19389366 2009 Bmi-1 over-expression in neural stem/progenitor cells increases proliferation and neurogenesis in culture but has little effect on these functions in vivo.
19386347 2009 Distinct expression of polycomb group proteins EZH2 and BMI1 in hepatocellular carcinoma.
19379548 2009 [Effect of silencing bmi-1 by RNA interference on function of K562 cell line].
19337376 2009 The synovial sarcoma-associated SYT-SSX2 oncogene antagonizes the polycomb complex protein Bmi1.
19269851 2009 Critical role of the Polycomb and Trithorax complexes in the maintenance of CD4 T cell memory.
19233177 2009 Identification of a polymorphism in the RING finger of human Bmi-1 that causes its degradation by the ubiquitin-proteasome system.
19228380 2009 Expression of Bmi-1 is a prognostic marker in bladder cancer.
19099625 2008 [Expression of SALL4 and BMI-1 mRNA in acute leukemia].
19080003 2008 [Expression and clinical significance of Bmi-1 protein in bladder cancer].
19080002 2008 [Expression and significance of Bmi-1 and Ki67 in colorectal carcinoma tissues].
19021148 2009 Oncoprotein BMI-1 induces the malignant transformation of HaCaT cells.
19012049 2009 Expression and distribution patterns of the stem cell marker, nestin, and the stem cell renewal factor, BMI-1, in normal human nasal mucosa and nasal polyps.
18829528 2008 The polycomb gene product BMI1 contributes to the maintenance of tumor-initiating side population cells in hepatocellular carcinoma.
18817867 2008 Bmi1 promotes prostate tumorigenesis via inhibiting p16(INK4A) and p14(ARF) expression.
18781299 2009 BMI-1 expression is enhanced through transcriptional and posttranscriptional regulation during the progression of chronic myeloid leukemia.
18701473 2008 BMI-1 promotes ewing sarcoma tumorigenicity independent of CDKN2A repression.
18668134 2008 HOX expression patterns identify a common signature for favorable AML.
18592462 2008 Overexpression of BMI1, a polycomb group repressor protein, in bladder tumors: a preliminary report.
18591938 2008 The overexpression of polycomb group proteins Bmi1 and EZH2 is associated with the progression and aggressive biological behavior of hepatocellular carcinoma.
18565849 2008 Association between BMI-1 expression, acute graft-versus-host disease, and outcome following allogeneic stem cell transplantation from HLA-identical siblings in chronic myeloid leukemia.
18475299 2008 Low BMI-1 expression is associated with an activated BMI-1-driven signature, vascular invasion, and hormone receptor loss in endometrial carcinoma.
18450386 2008 Expression of the Polycomb-Group protein BMI1 and correlation with p16 in astrocytomas an immunohistochemical study on 80 cases.
18439910 2008 Induction of neural stem cell-like cells (NSCLCs) from mouse astrocytes by Bmi1.
18438345 2008 Correlations of BMI-1 expression and telomerase activity in ovarian cancer tissues.
18427816 2008 Copy number alterations of the polycomb gene BMI1 in gliomas.
18347933 2008 BMI-1 expression is inversely correlated with the grading of renal clear cell carcinoma.
18346113 2008 Stem cell protein BMI-1 is an independent marker for poor prognosis in oligodendroglial tumours.
18269588 2008 Independent prognostic value of the basal-like phenotype of breast cancer and associations with EGFR and candidate stem cell marker BMI-1.
18264721 2008 Prognostic value of Bmi-1 oncoprotein expression in NSCLC patients: a tissue microarray study.
18246051 2008 Loss of BMI-1 expression is associated with clinical progress of malignant melanoma.
18228133 2009 Expression of Bmi-1 protein in tumor tissues is associated with favorable prognosis in breast cancer patients.
18156489 2008 Long-term maintenance of human hematopoietic stem/progenitor cells by expression of BMI1.
18094618 2008 BMI-1 autoantibody in serum as a new potential biomarker of nasopharyngeal carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17989714 2008 BMI1 as oncogenic candidate in a novel TCRB-associated chromosomal aberration in a patient with TCRgammadelta+ T-cell acute lymphoblastic leukemia.
17974970 2007 Bmi-1 cooperates with H-Ras to transform human mammary epithelial cells via dysregulation of multiple growth-regulatory pathways.
17917742 2008 Increased polycomb-group oncogene Bmi-1 expression correlates with poor prognosis in hepatocellular carcinoma.
17711569 2007 Circulating Bmi-1 mRNA as a possible prognostic factor for advanced breast cancer patients.
17666329 2007 [Association of Bmi-1 mRNA expression with differentiation, metastasis and prognosis of gastric carcinoma].
17625597 2008 Expression of Bmi-1 in epidermis enhances cell survival by altering cell cycle regulatory protein expression and inhibiting apoptosis.
17597110 2007 Consistent expression of the stem cell renewal factor BMI-1 in primary and metastatic melanoma.
17557835 2007 Bmi-1 is a target gene for SALL4 in hematopoietic and leukemic cells.
17545584 2007 Mel-18 acts as a tumor suppressor by repressing Bmi-1 expression and down-regulating Akt activity in breast cancer cells.
17454639 2007 Bmi-1 over-expression plays a secondary role in chronic myeloid leukemia transformation.
17452456 2007 Contribution of polycomb homologues Bmi-1 and Mel-18 to medulloblastoma pathogenesis.
17420273 2007 CDK4 and CDK6 delay senescence by kinase-dependent and p16INK4a-independent mechanisms.
17360938 2007 The polycomb group BMI1 gene is a molecular marker for predicting prognosis of chronic myeloid leukemia.
17344414 2007 The Polycomb group proteins bind throughout the INK4A-ARF locus and are disassociated in senescent cells.
17332741 2007 Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.
17298744 2007 [Expression and significance of Bmi-1 in breast cancer].
17233832 2007 Efficient immortalization of primary human cells by p16INK4a-specific short hairpin RNA or Bmi-1, combined with introduction of hTERT.
17179983 2007 Elevated Bmi-1 expression is associated with dysplastic cell transformation during oral carcinogenesis and is required for cancer cell replication and survival.
17161394 2007 Bmi-1 cooperates with human papillomavirus type 16 E6 to immortalize normal human oral keratinocytes.
17151361 2007 Mel-18, a polycomb group protein, regulates cell proliferation and senescence via transcriptional repression of Bmi-1 and c-Myc oncoproteins.
17148591 2007 Bmi-1 is induced by the Epstein-Barr virus oncogene LMP1 and regulates the expression of viral target genes in Hodgkin lymphoma cells.
17148583 2007 Comprehensive analysis of homeobox genes in Hodgkin lymphoma cell lines identifies dysregulated expression of HOXB9 mediated via ERK5 signaling and BMI1.
17145814 2006 Dysregulated expression of stem cell factor Bmi1 in precancerous lesions of the gastrointestinal tract.
17145810 2006 Implication of polycomb members Bmi-1, Mel-18, and Hpc-2 in the regulation of p16INK4a, p14ARF, h-TERT, and c-Myc expression in primary breast carcinomas.
17134822 2007 Polycomb-group oncogenes EZH2, BMI1, and RING1 are overexpressed in prostate cancer with adverse pathologic and clinical features.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982619 2006 Bmi-1 regulates the differentiation and clonogenic self-renewal of I-type neuroblastoma cells in a concentration-dependent manner.
16963837 2006 Essential role for activation of the Polycomb group (PcG) protein chromatin silencing pathway in metastatic prostate cancer.
16936260 2006 Decreased expression of Bmi1 is closely associated with cellular senescence in small bile ducts in primary biliary cirrhosis.
16882984 2006 E4F1: a novel candidate factor for mediating BMI1 function in primitive hematopoietic cells.
16874656 2006 BMI-1: a protein expressed in stem cells, specialized cells and tumors of the gastrointestinal tract.
16751658 2006 Role of Bmi1 in H2A ubiquitylation and Hox gene silencing.
16714294 2006 Structure of a Bmi-1-Ring1B polycomb group ubiquitin ligase complex.
16710298 2006 Structure and E3-ligase activity of the Ring-Ring complex of polycomb proteins Bmi1 and Ring1b.
16537449 2006 Reduced c-Myc signaling triggers telomere-independent senescence by regulating Bmi-1 and p16(INK4a).
16501599 2006 Loss of the human polycomb group protein BMI1 promotes cancer-specific cell death.
16359901 2005 Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314526 2005 Association of BMI1 with polycomb bodies is dynamic and requires PRC2/EZH2 and the maintenance DNA methyltransferase DNMT1.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16107895 2005 CALM-AF10+ T-ALL expression profiles are characterized by overexpression of HOXA and BMI1 oncogenes.
16105758 2005 BMI-1 is highly expressed in M0-subtype acute myeloid leukemia.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15897469 2005 Stable X chromosome inactivation involves the PRC1 Polycomb complex and requires histone MACROH2A1 and the CULLIN3/SPOP ubiquitin E3 ligase.
15563468 2005 MAPKAP kinase 3pK phosphorylates and regulates chromatin association of the polycomb group protein Bmi1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386022 2004 Role of histone H2A ubiquitination in Polycomb silencing.
15334543 2004 Structural integrity and expression of the L3MBTL gene in normal and malignant hematopoietic cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15029199 2004 Bmi1 is essential for cerebellar development and is overexpressed in human medulloblastomas.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14732230 2004 The Bmi-1 oncoprotein is overexpressed in human colorectal cancer and correlates with the reduced p16INK4a/p14ARF proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14536079 2003 Bmi-1 regulation of INK4A-ARF is a downstream requirement for transformation of hematopoietic progenitors by E2a-Pbx1.
12829790 2003 MLL repression domain interacts with histone deacetylases, the polycomb group proteins HPC2 and BMI-1, and the corepressor C-terminal-binding protein.
12714971 2003 Bmi-1 is required for maintenance of adult self-renewing haematopoietic stem cells.
12482990 2003 Control of the replicative life span of human fibroblasts by p16 and the polycomb protein Bmi-1.
12482919 2003 Polycomb group gene silencing proteins are concentrated in the perichromatin compartment of the mammalian nucleus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408802 2002 Plzf mediates transcriptional repression of HoxD gene expression through chromatin remodeling.
12183433 2002 The Bmi-1 oncogene induces telomerase activity and immortalizes human mammary epithelial cells.
12183370 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
11171983 2001 The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex.
10825164 2000 HPC3 is a new human polycomb orthologue that interacts and associates with RING1 and Bmi1 and has transcriptional repression properties.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10574711 1999 Chromatin-association of the Polycomb group protein BMI1 is cell cycle-regulated and correlates with its phosphorylation status.
10445843 1999 A human homolog of Drosophila lethal(3)malignant brain tumor (l(3)mbt) protein associates with condensed mitotic chromosomes.
9858531 1999 RING1 interacts with multiple Polycomb-group proteins and displays tumorigenic activity.
9367786 1997 MPc2, a new murine homolog of the Drosophila polycomb protein is a member of the mouse polycomb transcriptional repressor complex.
9199346 1997 RING1 is associated with the polycomb group protein complex and acts as a transcriptional repressor.
9121482 1997 Identification and characterization of interactions between the vertebrate polycomb-group protein BMI1 and human homologs of polyhomeotic.
9009205 1997 Identification of Bmi1-interacting proteins as constituents of a multimeric mammalian polycomb complex.
8390036 1993 flvi-2, a target of retroviral insertional mutagenesis in feline thymic lymphosarcomas, encodes bmi-1.
8268912 1993 Characterization and chromosomal localization of the human proto-oncogene BMI-1.