Property Summary

NCBI Gene PubMed Count 38
PubMed Score 52.19
PubTator Score 22.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 5.3e-06
glioblastoma 1.100 9.8e-06
group 3 medulloblastoma 1.600 3.8e-04
medulloblastoma, large-cell 1.400 1.3e-03

Synonym

Gene

BMF

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT      1 - 70
QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI     71 - 140
ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR                              141 - 184
//

Text Mined References (38)

PMID Year Title