Property Summary

NCBI Gene PubMed Count 20
PubMed Score 179.30
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.900 4.8e-07
osteosarcoma -2.967 4.6e-05
medulloblastoma, large-cell -2.000 7.8e-06
primitive neuroectodermal tumor -1.100 2.1e-02
tuberculosis 1.600 6.1e-07
pancreatic ductal adenocarcinoma liver m... -1.316 3.4e-03
lung cancer -1.200 2.0e-04
diabetes mellitus -1.200 1.3e-03
group 4 medulloblastoma -1.100 1.2e-03
non primary Sjogren syndrome sicca 1.100 3.6e-02
subependymal giant cell astrocytoma 1.282 3.8e-02
lung carcinoma -1.100 1.1e-21
mucosa-associated lymphoid tissue lympho... 2.024 7.6e-03
ovarian cancer -1.800 7.2e-06

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
26708147 miR-127-5p suppressed NF-kappaB activity by directly targeting BLVRB in hepatocellular carcinoma cells.
25726384 Data suggest that isoenzymes BVRA and BVRB play different roles in energy metabolism and in pathogenesis of abdominal obesity and hypertriglyceridemia. [REVIEW]
18241201 quantum mechanics/molecular mechanics potential energy surfaces show that the lowest energy pathway proceeds with a positively charged pyrrole intermediate via two transition states

AA Sequence

MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDA      1 - 70
VIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLR     71 - 140
ESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ        141 - 206
//

Text Mined References (27)

PMID Year Title
26708147 2016 MicroRNA-127-5p targets the biliverdin reductase B/nuclear factor-?B pathway to suppress cell growth in hepatocellular carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726384 2015 Biliverdin reductase isozymes in metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18241201 2008 Computational and experimental studies on the catalytic mechanism of biliverdin-IXbeta reductase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12909459 2003 Heme oxygenase-1: unleashing the protective properties of heme.
12626517 2003 The binding sites on human heme oxygenase-1 for cytochrome p450 reductase and biliverdin reductase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11224564 2001 Structure of human biliverdin IXbeta reductase, an early fetal bilirubin IXbeta producing enzyme.
10620517 2000 Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B).
8799475 1996 Molecular cloning and expression of human liver biliverdin-IX beta reductase.
8687377 1996 Evidence that biliverdin-IX beta reductase and flavin reductase are identical.
8313871 1993 Plasma and red blood cell protein maps: update 1993.
8280170 1993 Complete amino acid sequence of biliverdin-IX beta reductase from human liver.
8117274 1994 Cloning and nucleotide sequence of a cDNA of the human erythrocyte NADPH-flavin reductase.
7929092 1994 Biliverdin-IX alpha reductase and biliverdin-IX beta reductase from human liver. Purification and characterization.
7656592 1995 Mapping of the newly identified biliverdin-IX beta reductase gene (BLVRB) to human chromosome 19q13.13-->q13.2 by fluorescence in situ hybridization.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.