Property Summary

NCBI Gene PubMed Count 28
PubMed Score 64.81
PubTator Score 11.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 5.234 3.2e-10
acute quadriplegic myopathy 1.101 7.4e-05
aldosterone-producing adenoma -1.040 3.7e-02
Pick disease -1.200 6.1e-04
ovarian cancer 2.500 2.4e-04

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
23750231 Mecp2 regulates the expression of components belonging to the dysbindin interactome
12576321 no defects in the known components of pallidin-muted complex (BLOC-1)have been identified in 142 patients with HPS, suggesting that BLOC-1 function may be critical in humans.
12191018 role in biogenesis of lysosome-related organelles

AA Sequence

MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA      1 - 70
LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ     71 - 140
QKRQKEELEREQQREKEFEREKQLTARPAKRM                                          141 - 172
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24987500 2014 Highly expressed genes in human high grade gliomas: immunohistochemical analysis of data from the human protein atlas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23750231 2013 MeCP2 regulates the synaptic expression of a Dysbindin-BLOC-1 network component in mouse brain and human induced pluripotent stem cell-derived neurons.
23563589 2013 An association study of the Hermansky-Pudlak syndrome type 4 gene in schizophrenic patients.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21998198 2011 The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.
21665000 2011 A BLOC-1 mutation screen reveals that PLDN is mutated in Hermansky-Pudlak Syndrome type 9.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15102850 2004 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923531 2003 Hermansky-Pudlak syndrome type 7 (HPS-7) results from mutant dysbindin, a member of the biogenesis of lysosome-related organelles complex 1 (BLOC-1).
12576321 2003 Cappuccino, a mouse model of Hermansky-Pudlak syndrome, encodes a novel protein that is part of the pallidin-muted complex (BLOC-1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191018 2002 Pallidin is a component of a multi-protein complex involved in the biogenesis of lysosome-related organelles.
12019270 2002 BLOC-1, a novel complex containing the pallidin and muted proteins involved in the biogenesis of melanosomes and platelet-dense granules.
11936273 2002 The pallidin (Pldn) gene and the role of SNARE proteins in melanosome biogenesis.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10610180 1999 The pallid gene encodes a novel, syntaxin 13-interacting protein involved in platelet storage pool deficiency.
9110174 1997 Large-scale concatenation cDNA sequencing.
8986625 1996 Role of N-myristylation in targeting of band 4.2 (pallidin) in nonerythroid cells.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8608138 1996 Human erythrocyte dematin and protein 4.2 (pallidin) are ATP binding proteins.
2968981 1988 Associations of human erythrocyte band 4.2. Binding to ankyrin and to the cytoplasmic domain of band 3.