Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 139.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.5e-04
group 4 medulloblastoma 1875 1.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.021 1.5e-04
group 4 medulloblastoma 1.200 1.7e-04

Synonym

Accession Q9NUP1 Q6NVY6 Q96G84 BLOC-1 subunit 4
Symbols CNO
BLOS4
BCAS4L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
22203954 Melanoma cells depleted of cappuccino protein have increased nuclear localization of cis-diaminedichloroplatinum II, increased nuclear DNA damage by platination, and increased apoptosis, resulting in increased treatment sensitivity.

AA Sequence

MEGSFSDGGALPEGLAEEAEPQGAAWSGDSGTVSQSHSSASGPWEDEGAEDGAPGRDLPLLRRAAAGYAA      1 - 70
CLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEA     71 - 140
FVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPC    141 - 210
CSERPQL                                                                   211 - 217
//

Text Mined References (15)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22203954 2012 Targeting protein-trafficking pathways alters melanoma treatment sensitivity.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15102850 2004 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923531 2003 Hermansky-Pudlak syndrome type 7 (HPS-7) results from mutant dysbindin, a member of the biogenesis of lysosome-related organelles complex 1 (BLOC-1).
12576321 2003 Cappuccino, a mouse model of Hermansky-Pudlak syndrome, encodes a novel protein that is part of the pallidin-muted complex (BLOC-1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191018 2002 Pallidin is a component of a multi-protein complex involved in the biogenesis of lysosome-related organelles.
11252894 2000 Three ways to make a vesicle.
11110696 2000 Defects in the cappuccino (cno) gene on mouse chromosome 5 and human 4p cause Hermansky-Pudlak syndrome by an AP-3-independent mechanism.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.