Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 139.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-04
group 4 medulloblastoma 1855 1.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.200 1.7e-04
osteosarcoma 1.021 1.5e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MEGSFSDGGALPEGLAEEAEPQGAAWSGDSGTVSQSHSSASGPWEDEGAEDGAPGRDLPLLRRAAAGYAA      1 - 70
CLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEA     71 - 140
FVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPC    141 - 210
CSERPQL                                                                   211 - 217
//

Text Mined References (15)

PMID Year Title