Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.16
PubTator Score 9.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (11)

AA Sequence

MAPGSRGERSSFRSRRGPGVPSPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHL      1 - 70
NVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATAL     71 - 140
EYVYKGQLQSAPS                                                             141 - 153
//

Text Mined References (33)

PMID Year Title