Property Summary

NCBI Gene PubMed Count 54
PubMed Score 568.19
PubTator Score 203.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 8.2e-04
osteosarcoma -3.711 5.6e-05
glioblastoma 1.100 2.5e-02
medulloblastoma, large-cell -1.300 3.0e-03
tuberculosis 1.100 7.9e-03
intraductal papillary-mucinous adenoma (... 1.600 4.1e-04
intraductal papillary-mucinous carcinoma... 1.300 8.4e-03
lung cancer -2.800 6.4e-05
colon cancer -1.900 4.0e-02
cystic fibrosis 1.100 3.2e-04
adult high grade glioma 1.700 1.1e-02
group 3 medulloblastoma -1.500 1.1e-02
pilocytic astrocytoma 2.200 1.3e-06
primary Sjogren syndrome 1.900 1.2e-03
psoriasis 1.500 1.0e-13
subependymal giant cell astrocytoma 2.507 5.0e-03
invasive ductal carcinoma 1.600 7.7e-03
lung carcinoma -1.200 1.0e-18
ductal carcinoma in situ 1.500 4.4e-05
acute myeloid leukemia -2.900 2.5e-03
ovarian cancer 1.100 1.4e-03

Synonym

Accession Q8WV28 O75498 O75499 Q2MD49
Symbols bca
AGM4
BASH
LY57
SLP65
BLNK-S
SLP-65

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
25140054 vesicular signaling scaffolds are required for B cell activation indicates that vesicles may deliver preassembled signaling cargo to sites of BCR activation.
24166973 early Ca(2+) fluxing provides feed-forward signal amplification by promoting anchoring of the PLCgamma2 C2 domain to phospho-SLP65.
22689681 up-regulation of BLNK is associated with RUNX1 mutations in cytogenetically normal acute myeloid leukemia.
21822214 Live cell imaging and co-immunoprecipitation experiments confirmed that both SLP65 and CIN85 are both required for the onset and progression phases of B-cell antigen receptor signal transduction.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19372136 Data show that SLP-65 phosphorylation acts upstream for signal initiation and also downstream during selective processing of the B cell receptor signal.
19218240 BLNK recruits active H-Ras to the BCR complex, which is essential for sustained surface expression of BCR in the form of the cap and for the signal leading to functional ERK activation
19018766 BLNK prevents aneuploidy by inhibiting cytokinesis.
18022864 Plasmacytoid dendritic cells express a signalosome consisting of Lyn, Syk, Btk, Slp65 (Blnk) and PLCgamma2. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 & cytoskeletal proteins.
17681949 Syk is required to link phosphorylated SLP-65 to Ca(2+) mobilization.
16636677 V(H) gene rearrangement represents a frequent feature in B-lymphoid malignancy, which can be attributed to SLP65 deficiency in many cases.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16356554 In B cells SLP-65 exists in a 180 kDa complex as well as in monomeric form.
15744341 The BLNK protein is present in the majority of mediastinal B cell lymphomas.
15588985 Identifies BLNK as a potential target for the protein-tyrosine phosphatase SHP-1.
12761551 16 of the 34 childhood pre-B acute lymphoblastic leukaemia samples that were tested showed a complete loss or drastic reduction of SLP-65 expression

AA Sequence

MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDS      1 - 70
DYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKP     71 - 140
SWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRST    141 - 210
KPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAER    211 - 280
HRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGA    281 - 350
CDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG    351 - 420
SVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS                                      421 - 456
//

Text Mined References (56)

PMID Year Title
25140054 2014 Macromolecular assembly of the adaptor SLP-65 at intracellular vesicles in resting B cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24166973 2013 Cutting edge: feed-forward activation of phospholipase C?2 via C2 domain-mediated binding to SLP65.
22689681 2012 RUNX1 mutations in cytogenetically normal acute myeloid leukemia are associated with a poor prognosis and up-regulation of lymphoid genes.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
21822214 2011 The B-cell antigen receptor signals through a preformed transducer module of SLP65 and CIN85.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19372136 2009 SLP-65 phosphorylation dynamics reveals a functional basis for signal integration by receptor-proximal adaptor proteins.
19218240 2009 BLNK binds active H-Ras to promote B cell receptor-mediated capping and ERK activation.
19018766 2008 B-cell linker protein prevents aneuploidy by inhibiting cytokinesis.
18369315 2008 The kinase Syk as an adaptor controlling sustained calcium signalling and B-cell development.
18022864 2007 CD303 (BDCA-2) signals in plasmacytoid dendritic cells via a BCR-like signalosome involving Syk, Slp65 and PLCgamma2.
17681949 2007 SLP-65 signal transduction requires Src homology 2 domain-mediated membrane anchoring and a kinase-independent adaptor function of Syk.
16969585 2006 Solution structure and phosphopeptide binding of the SH2 domain from the human Bruton's tyrosine kinase.
16912232 2006 Human SLP-65 isoforms contribute differently to activation and apoptosis of B lymphocytes.
16636677 2006 SLP65 deficiency results in perpetual V(D)J recombinase activity in pre-B-lymphoblastic leukemia and B-cell lymphoma cells.
16568084 2006 The SRC family kinase LYN redirects B cell receptor signaling in human SLP65-deficient B cell lymphoma cells.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16356554 2006 Two dimensional Blue Native-/SDS-PAGE analysis of SLP family adaptor protein complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15744341 2005 Expression pattern of intracellular leukocyte-associated proteins in primary mediastinal B cell lymphoma.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15270728 2004 Deficiency of BLNK hampers PLC-gamma2 phosphorylation and Ca2+ influx induced by the pre-B-cell receptor in human pre-B cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15087455 2004 Identification and characterization of a novel BASH N terminus-associated protein, BNAS2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773374 2003 Structural basis for SH3 domain-mediated high-affinity binding between Mona/Gads and SLP-76.
12761551 2003 Deficiency of the adaptor SLP-65 in pre-B-cell acute lymphoblastic leukaemia.
12514734 2003 LAB: a new membrane-associated adaptor molecule in B cell activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456653 2002 BLNK: molecular scaffolding through 'cis'-mediated organization of signaling proteins.
12176364 2002 A high-affinity Arg-X-X-Lys SH3 binding motif confers specificity for the interaction between Gads and SLP-76 in T cell signaling.
12093870 2002 Cbl-b positively regulates Btk-mediated activation of phospholipase C-gamma2 in B cells.
11909947 2002 The direct recruitment of BLNK to immunoglobulin alpha couples the B-cell antigen receptor to distal signaling pathways.
11514608 2001 B cell adaptor containing src homology 2 domain (BASH) links B cell receptor signaling to the activation of hematopoietic progenitor kinase 1.
11489945 2001 Epstein-Barr virus latent membrane protein 2A (LMP2A) employs the SLP-65 signaling module.
11487585 2001 Hematopoietic progenitor kinase 1 associates physically and functionally with the adaptor proteins B cell linker protein and SLP-76 in lymphocytes.
11449366 2001 Association of SLP-65/BLNK with the B cell antigen receptor through a non-ITAM tyrosine of Ig-alpha.
11356834 2001 SHP-1 requires inhibitory co-receptors to down-modulate B cell antigen receptor-mediated phosphorylation of cellular substrates.
11274146 2001 The adaptor protein BLNK is required for b cell antigen receptor-induced activation of nuclear factor-kappa B and cell cycle entry and survival of B lymphocytes.
11071869 2000 Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes.
10981967 2000 Engagement of the human pre-B cell receptor generates a lipid raft-dependent calcium signaling complex.
10903736 2000 Src homology region 2 (SH2) domain-containing phosphatase-1 dephosphorylates B cell linker protein/SH2 domain leukocyte protein of 65 kDa and selectively regulates c-Jun NH2-terminal kinase activation in B cells.
10820378 2000 BLNK is associated with the CD72/SHP-1/Grb2 complex in the WEHI231 cell line after membrane IgM cross-linking.
10583958 1999 An essential role for BLNK in human B cell development.
10556826 1999 Interaction of SLP adaptors with the SH2 domain of Tec family kinases.
10498607 1999 Identification of the SH2 domain binding protein of Bruton's tyrosine kinase as BLNK--functional significance of Btk-SH2 domain in B-cell antigen receptor-coupled calcium signaling.
9705962 1998 SLP-65: a new signaling component in B lymphocytes which requires expression of the antigen receptor for phosphorylation.
9697839 1998 BLNK: a central linker protein in B cell activation.
9341187 1997 Identification of two tyrosine phosphoproteins, pp70 and pp68, which interact with phospholipase Cgamma, Grb2, and Vav after B cell antigen receptor activation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.