Property Summary

Ligand Count 28
NCBI Gene PubMed Count 81
PubMed Score 81.58
PubTator Score 82.13

Knowledge Summary

Patent (12,029)

TINX Plot

  Disease (9)

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 2.200 4.9e-03
osteosarcoma -1.613 1.5e-05

Gene RIF (58)

AA Sequence

MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYT      1 - 70
AMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLA     71 - 140
PINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGD    141 - 210
GLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEA    211 - 280
FLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY    281 - 350
IERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS    351 - 420
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVL    421 - 490
EDFYTATERQYELQP                                                           491 - 505
//

Text Mined References (87)

PMID Year Title