Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.15
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.4e-03
Disease Target Count Z-score Confidence
Myopia 176 3.084 1.5

Gene RIF (10)

AA Sequence

MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRY      1 - 70
NLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL                                     71 - 108
//

Text Mined References (13)

PMID Year Title