Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.15
PubTator Score 8.33

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 5.4e-03
Disease Target Count Z-score Confidence
Myopia 99 3.153 1.6

Gene RIF (10)

25728273 Results showed that the expression of BLID is frequently downregulated in non-small cell lung tumors and cell lines and inversely correlates with miR-575 expression.
24532431 loss of BLID may contribute to the progression of intraductal proliferation lesions to breast cancer.
23928696 BRCC2 functions as a novel tumor suppressor in breast cancer and may be a potential therapeutic target for breast cancer management.
21846966 Frequent loss of the BLID gene is observed in early-onset breast cancer.
21031016 Tag single nucleotide polymorphisms near the BLID and LOC399959 genes are not susceptibility loci for high myopia in the Chinese Han population.
20544842 BLID upregulation resulting from a novel IGH translocation is associated with childhood B-Cell precursor acute lymphoblastic leukemia.
20400521 BLID is a new binding partner of Bcl-X(L) and a significant prognostic factor in breast cancer
19779542 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18940476 BLID gene is assigned to 11p24.1.
15069058 BRCC2 is a novel BH3-like domain-containing protein which induces apoptosis in a caspase-dependent manner

AA Sequence

NLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL                                     71 - 108

Text Mined References (13)

PMID Year Title
25728273 2015 MicroRNA-575 targets BLID to promote growth and invasion of non-small cell lung cancer cells.
24532431 2014 Aberrant BLID expression is associated with breast cancer progression.
23928696 2013 BRCC2 inhibits breast cancer cell growth and metastasis in vitro and in vivo via downregulating AKT pathway.
21846966 2011 Frequent loss of the BLID gene in early-onset breast cancer.
21031016 2010 Evaluation of BLID and LOC399959 as candidate genes for high myopia in the Chinese Han population.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20544842 2010 MicroRNA-125b-1 and BLID upregulation resulting from a novel IGH translocation in childhood B-Cell precursor acute lymphoblastic leukemia.
20400521 2010 The proapoptotic molecule BLID interacts with Bcl-XL and its downregulation in breast cancer correlates with poor disease-free and overall survival.
19779542 2009 A genome-wide association analysis identified a novel susceptible locus for pathological myopia at 11q24.1.
18940476 2008 Assignment of the BLID gene to 11q24.1 by fluorescence in situ hybridization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15069058 2004 BRCC2, a novel BH3-like domain-containing protein, induces apoptosis in a caspase-dependent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.