Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.70
PubTator Score 22.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (7)

PMID Text
25499081 Data show that the RNA-edited bladder cancer associated protein (BLCAP) gene may stably promote cell proliferation.
23049907 Immunoexpression analysis and prognostic value of BLCAP in breast cancer
19908260 observed a general decrease in BLCAP-editing level in astrocytomas, bladder cancer and colorectal cancer when compared with the related normal tissues
19783793 Data show that loss of BLCAP expression is associated with tumor progression.
18836209 Blcap is imprinted in mouse and human brain, but not in other mouse tissues.
17031575 BLCAP may play a role not only in regulating cell proliferation but also in coordinating apoptosis and cell cycle via a novel way independent of p53 and NF-kappaB.
16675915 might be a potential tumor suppressor gene in cervical carcinoma.

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC      1 - 70
SDSPLPESAHDPGVVGT                                                          71 - 87
//

Text Mined References (25)

PMID Year Title
26986503 2016 BLCAP arrests G?/S checkpoint and induces apoptosis through downregulation of pRb1 in HeLa cells.
26186239 2015 Placental expression profile of imprinted genes impacts birth weight.
25499081 2015 RNA over-editing of BLCAP contributes to hepatocarcinogenesis identified by whole-genome and transcriptome sequencing.
25416956 2014 A proteome-scale map of the human interactome network.
23049907 2012 Immunoexpression analysis and prognostic value of BLCAP in breast cancer.
21844121 2011 BLCAP induces apoptosis in human Ewing's sarcoma cells.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
19908260 2010 Human BLCAP transcript: new editing events in normal and cancerous tissues.
19783793 2010 Bladder cancer-associated protein, a potential prognostic biomarker in human bladder cancer.
18836209 2009 Transcript- and tissue-specific imprinting of a tumour suppressor gene.
17031575 2007 Overexpression of BLCAP induces S phase arrest and apoptosis independent of p53 and NF-kappaB in human tongue carcinoma : BLCAP overexpression induces S phase arrest and apoptosis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16675915 2006 Functional analysis of bladder cancer-related protein gene: a putative cervical cancer tumor suppressor gene in cervical carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15797904 2005 A bioinformatic screen for novel A-I RNA editing sites reveals recoding editing in BC10.
15731336 2005 Evolutionarily conserved human targets of adenosine to inosine RNA editing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136878 2002 bc10: a novel human bladder cancer-associated protein with a conserved genomic structure downregulated in invasive cancer.
11920613 2002 bc10: A novel human bladder cancer-associated protein with a conserved genomic structure downregulated in invasive cancer.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10197429 1999 Identification of true differentially expressed mRNAs in a pair of human bladder transitional cell carcinomas using an improved differential display procedure.