Property Summary

Ligand Count 1
NCBI Gene PubMed Count 111
PubMed Score 206.77
PubTator Score 201.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
psoriasis 6694 1.5e-16
Disease Target Count Z-score Confidence
Cancer 2499 4.505 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.5e-16

PDB (13)

Gene RIF (100)

AA Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG      1 - 70
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP     71 - 140
WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS    141 - 210
ESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQ    211 - 280
LCPICRAPVRSRVRTFLS                                                        281 - 298
//

Text Mined References (113)

PMID Year Title