Property Summary

NCBI Gene PubMed Count 105
PubMed Score 194.05
PubTator Score 201.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
psoriasis 6685 1.5e-16
Disease Target Count Z-score Confidence
Cancer 2346 4.443 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.5e-16

Gene RIF (94)

PMID Text
26823716 Expression of livin, survivin and caspase-3 are closely related to the occurrence and development of prostatic cancer.
26708654 The apoptosisinducing effects of livin and surivin knockdown were investigated using a Hoechst staining kit.
26412467 Our results suggested the important role of Livin and its partner molecule in the process of VSV treatment
26122233 Livin expression was higher in condyloma acuminatum than in normal cells and was correlated with survivin and Ki-67.
26094984 Data showed that Livin knock-down suppressed cell proliferation and inhibited cell invasion, accompanied by downregulation of VEGF and MMP-2/-9. Its silencing resulted in the prevention of xenograft tumor formation.
25695324 These findings suggest that livin may be used as a novel target for tumor gene therapy.
25374170 Livin gene has a high expression in osteosarcoma and inhibits apoptosis in tumor tissue.
25370472 Upregulation of Livin expression and downregulation of caspase activity are observed under cycling and chronic hypoxia in glioblastoma cells and xenografts.
25339450 These data suggest that livin overexpression plays an important role in tumor invasiveness by mediating resistance to apoptosis.
25261663 Co-silencing of Livin and Survivin can effectively inhibit the cell proliferation and apoptosis of lung cancer cells.
25242075 livin is associated with invasive and oncogenic phenotypes such as tumor cell invasion, tumor cell migration, tumor cell proliferation, and resistance to apoptosis in human oral squamous cell carcinoma cells.
25090821 Livin expression was not associated with survival in pancreas ductal adenocarcinoma.
24938471 effectively silence Livin gene expression in LoVo colon cancer cells, inhibit cell proliferation and colony formation, induce apoptosis, and enhance sensitivity to cisplatin
24767895 In diagnostically difficult cases of diffuse large B-cell lymphoma and Hodgkin lymphoma, focus on livin as marker may provide useful corroborative information.
24696218 Low livin expression is associated with childhood acute lymphoblastic leukemia.
24295240 The expression of Livin was was independently related to survival in rectal cancer patients
24287698 Data suggest that Livin has a role in thrombopoiesis by regulating the apoptotic and antiapoptotic balance in MK endoreplication and platelet production.
24220265 our findings indicate that the expression of Livin is increased in human GC and correlates with tumor differentiation and lymph node metastases
24023847 Livin is associated with tumor progression by increasing tumor cell motility and inhibiting apoptosis in colorectal cancer
24008725 no significant correlation was found between Livin expression and various clinicopathological parameters including survival.
23906305 High BIRC7 expression is associated with lymph node metastasis in squamous cell/adenosquamous carcinomas and adenocarcinoma of gallbladder.
23781587 Livin may inhibit apoptosis in cervical squamous cell carcinoma by downregulating caspase-3, thereby promoting disease progression.
23632777 our data suggest that Livin is involved in tumorigenesis of human osteosarcoma and may serve as a promising therapeutic target for osteosarcoma.
23563149 Livin interaction with caspase-3 and Livin role in the regulation of cell death
23524337 Livin expression promotes breast cancer metastasis through the activation of AKT signaling and induction of EMT in breast cancer cells both in vitro and in vivo.
23480510 BRG1 regulates ML-IAP expression by cooperating with MITF to promote transcriptionally permissive chromatin structure on the ML-IAP promoter.
23404657 High livin expression is associated with lymph node micrometastasis in non-small cell lung cancer.
23343959 Livin expression was positively correlated with the proliferation marker Ki-67, but was negatively correlated with caspase-3 expression in human ampullary carcinoma patients.
23188704 Overexpression of Livin led to cisplatin resistance in colon cancer.
23069480 Livin expression may be regulated by miR-198 in human prostate cancer cell lines.
23030305 study demonstrated the expression of inhibitor of apoptosis proteins, survivin and Livin and the pro-apoptotic protein TSP-1 in endemic Burkitt lymphoma (BL); no significant difference was found between BL and reactive lymphoid hyperplasia
23029054 our data reveal a new, Livin-dependent, apoptotic role for TEAD1 in mammals and provide mechanistic insight downstream of TEAD1 deregulation in cancers.
22938441 study concludes PTEN and Livin are important in renal clear cell carcinoma development
22932199 The increased expression of CD44v6 and Livin in gastric cancer tissue may be closely related with development and progression of gastric cancer.
22931613 Genistein can suppress Livin gene expression, induce melanoma cell apoptosis, hinder the cell cycle, and restrain cell proliferation.
22930255 Survivin and livin mRNA levels in patients with lung cancer were significantly higher than in those with benign lung disease.
22902369 Presented is the structure of the human dimeric RING domain from BIRC7 in complex with the E2 UbcH5B covalently linked to Ub.
22766624 data suggested that livin plays an important role in inhibiting the apoptosis of ovarian cancer cells
22711539 unknown role for ML-IAP in controlling C-RAF stability and cell migration.
22427141 livin induction of fibronectin regulates tumor cell invasion via nuclear factor kappa-B signaling
22086237 High Livin is associated with glioma.
22033581 A broad array of CD4(+) and CD8(+) cellular responses against ML-IAP was observed with novel class I and class II epitopes identified.
21867615 Livin and survivin may be involved in the pathogenesis and progression of adult acute lymphoblastic leukemia.
21867610 Bortezomib and arsenic trioxide can induce apoptosis by inhibiting the expression of livin mRNA in Jurkat cells.
21700335 Livin expression is a novel prognostic marker in adult acute leukemia and thus needs to be incorporated into the patient stratification and treatment protocols.
21617971 this review introduces Livin structure, biological function, and its role in cancer formation and progression and the possible interventions for cancer therapy.
21122381 JNK1, Raf-1 and Livin may be involved in the carcinogenesis of sporadic colorectal tubular adenoma.
20717925 VEGF stimulation results in mTOR signaling activation which changes the phosphorylation status of 4E-BP1, the downstream of mTOR signaling, and ultimately contributes to the translation initiation of Livin protein
20691667 These findings suggest that livin may contribute to drug resistance in neuroblastoma.
20607788 Livin-alpha may promote cell proliferation by regulating G(1)-S cell cycle transition and possibly play an important part in initiation of prostate cancer.
20584688 Livin overexpression at the invasive tumor front of oral squamous cell carcinoma may indicate greater malignancy and higher likeliness of tumor recurrence and metastasis.
20460713 Livin knockdown can inhibit cell growth and increase sensitivity to apoptotic stimuli, and might serve as a potent target in bladder cancer gene therapy.
20416174 Livin mRNA and protein are highly expressed in non-Hodgkin's lymphoma patients and are positively correlated with many clinical features.
20388502 after Etoposide intervention glioblastoma stem-like cells showed a stronger resistance to apoptosis and death, and the anti-apoptotic gene livinbeta was related with the high survival rate
20237496 Observational study of gene-disease association. (HuGE Navigator)
20109966 investigated the expression of three apoptosis related genes, BCL2L13, CASP8AP2, and Livin, as well as their prognostic significance, in a retrospective study of 90 pediatric ALL patients diagnosed between 1996 and 2007 in Taiwan
19914791 Livin is overexpressed in gastric carcinoma with a relationship to tumor differentiation and lymph node metastases
19806913 Inhibiting Livin and survivin expression with siRNA reduces colon cancer cell proliferation.
19724862 MycN is required for livin expression and that livin may counteract the proapoptotic effects of MycNin neuroblastoma cells.
19690982 The results suggest that livin may exert anti-apoptotic action on SPC-A1 by activating JNK1 signaling pathway and inhibiting caspase-3 activation.
19635196 The expression and correlation of Livin and Smac/DIABLO vary in different stages and pathological types of gastric carcinoma. Overexpression of Livin is closely related to differentiation and metastases of gastric carcinoma.
19549891 Livin plays a major role in tumorigenicity and that natural killer cells induce cleavage of Livin to its proapoptotic truncated protein that in turn inhibits tumor growth, shown here in transgenic NOD SCIID mice.
19397802 Study demonstrates that alterations in the expression of IAP family members, including Survivin and Livin/ML-IAP, are frequent in hepatocellular carcinoma (HCC).
19074843 review of the current understanding of the versatile roles of Livin in the apoptotic cascade [review]
18837095 Over-expression of livin and VEGF contributes to the pathogenesis of esophageal carcinoma.
18827979 Results showed that knockdown livin expression could inhibit cell growth and induce apoptosis in A549 and 103H non-small cell lung cancer cell lines.
18555709 Livin may serve as a promising marker to identify the relapse risk in bladder cancer, and targeting Livin could offer a therapeutic benefit in apoptosis-inducing treatment.
18515985 Livin is implicated in testicular tumorigenesis and to be related to the histological testicular germ cell tumors subtype.
18476630 The positive rate of Livin was higher in LSCC than that in normal soft palate tissue and the expression was significantly associated with lymph node metastasis.
18451137 MITF is a major transcriptional regulator of ML-IAP expression in melanomas.
18315896 Overexpression of livin gene may play a synergic role in the pathogenesis of in acute non-lymphocytic leukemia and associates with complete remission.
18278467 Livin expression may have a role in the development of bladder cancer
18210873 Livin is overexpressed in gastric carcinoma with a correlation to tumor differentiation and lymph node metastasis.
18034418 Livin beta moderately protects against NK cell killing whereas Livin alpha augments killing. Livin augments an extrinsic inhibitory signal rather than functioning as an independent inhibitory mechanism.
18031611 Silencing livin could significantly induce apoptosis, arrest cell cycle at the G0/G1 phase, and inhibit proliferation in LiBr cells
17968430 Increased livin protein expression is associated with renal cell carcinoma
17672950 Both Survivin and Livin were correlated to tumor recurrence and/or metastasis, and shorter survival.
17632732 High Livin expression is associated with osteosarcoma
17519534 Livin expression is detected in 59 (38.8%) of 152 renal cell carcinoma specimens but not any in normal samples.
17437058 Livin can contribute significantly to the apoptosis resistance of renal cell carcinoma cells.
17294084 study demonstrates that only the first N-terminal glycine residue dictates the peri-nuclear distribution of tLivin; once it is properly localized, an intact RING domain enables pro-apoptotic function
17035597 Deguelin has great potential for chemosensitization of this protein and could represent a new therapeutic agent for treatment of breast cancer.
16990595 The Livin expression is a novel prognostic marker in childhood ALL and thus needs to be incorporated into the patient stratification and treatment protocols.
16965834 Targeted inhibition of livin strongly sensitized NSCLC cells to different pro-apoptotic stimuli, such as UV-irradiation or the chemotherapeutic drug etoposide thus Livin is an important contributor to the apoptosis resistance of NSCLC cells.
16840203 the BIRC7 gene might play a role in the development and aggression of non-Hodgkin's lymphoma
16806840 Livin cleavage in melanoma cells occurs in an Omi-independent fashion at residue 52 within its potential caspase substrate and suggests the involvement of a non-canonical caspase.
16729033 findings provide a novel function of Livin: it exhibits E3 ubiquitin ligase activity to degrade the pivotal apoptotic regulator Smac/DIABLO through the ubiquitin-proteasome pathway.
16437214 Livin beta isoform plays the key role for the antiapoptotic protection of HeLa cells by the livin gene. the Livin isoforms can strongly differ in their functional significance for the antiapoptotic resistance of tumor cells.
16026775 Like survivin, livin may act as a major cancer antigen in breast cancer patients
15541814 livin gene may play a role in NSCLC development and increased expression of livin mRNA may serve as a new target for lung cancer treatment as well as survivin
15009721 T cells in a large proportion of melanoma patients infiltrating the tumor or circulating in the peripheral blood specifically recognize ML-IAP-derived peptides
14614456 livin gene is susceptible to efficient and specific silencing by the siRNA technology
12488298 alpha isoform of LIVIN, which is not expressed in normal bladder tissue, is expressed in a proportion of bladder carcinoma with a high risk of relapse
11801603 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP).

AA Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG      1 - 70
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP     71 - 140
WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS    141 - 210
ESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQ    211 - 280
LCPICRAPVRSRVRTFLS                                                        281 - 298
//

Text Mined References (107)

PMID Year Title
26823716 2015 Expression of livin, survivin and caspase-3 in prostatic cancer and their clinical significance.
26708654 2016 Effects of RNA interference-mediated knockdown of livin and survivin using monomethoxypolyethylene glycol-chitosan nanoparticles in MG-63 osteosarcoma cells.
26412467 2015 Livin modulates the apoptotic effects of vesicular stomatotitis virus in lung adenocarcinoma.
26122233 EXPRESSION AND CLINICAL SIGNIFICANCE OF APOPTOSIS-ASSOCIATED PROTEINS SURVIVIN AND LIVIN IN CONDYLOMA ACUMINATUM.
26094984 2015 Silencing of Livin inhibits tumorigenesis and metastasis via VEGF and MMPs pathway in lung cancer.
25695324 2015 Inhibition of livin expression suppresses cell proliferation and enhances chemosensitivity to cisplatin in human lung adenocarcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25374170 2014 Research progress on the livin gene and osteosarcomas.
25370472 2015 Livin contributes to tumor hypoxia-induced resistance to cytotoxic therapies in glioblastoma multiforme.
25339450 2014 Expression of the apoptosis inhibitor livin in colorectal adenoma-carcinoma sequence: correlations with pathology and outcome.
25261663 Effects of shRNA-silenced livin and survivin on lung cancer cell proliferation and apoptosis.
25242075 2014 Relationship between expression of Livin and the biological behavior of human oral squamous cell carcinoma.
25090821 2014 The prognostic significance of clinicopathological features and apoptosis inhibitor proteins in pancreas ductal adenocarcinoma.
24938471 2014 Effect of RNAi-mediated silencing of Livin gene on biological properties of colon cancer cell line LoVo.
24767895 2014 Livin, a novel marker in lymphoma type distinction.
24696218 2014 Expression and prognostic significance of livin/BIRC7 in childhood acute lymphoblastic leukemia.
24295240 2013 Livin expression is an independent factor in rectal cancer patients with or without preoperative radiotherapy.
24287698 2013 Differential regulation of the apoptotic machinery during megakaryocyte differentiation and platelet production by inhibitor of apoptosis protein Livin.
24220265 2014 Knockdown of Livin inhibits growth and invasion of gastric cancer cells through blockade of the MAPK pathway in vitro and in vivo.
24023847 2013 Expression of Livin in colorectal cancer and its relationship to tumor cell behavior and prognosis.
24008725 2013 Expression and prognostic significance of Livin in gastric cancer.
23906305 2013 Comparative study of clinicopathological significance, BIRC7, and STC2 expression between squamous cell/adenosquamous carcinomas and adenocarcinoma of gallbladder.
23781587 2013 Livin and caspase-3 expression are negatively correlated in cervical squamous cell cancer.
23632777 2013 RNA interference-mediated knockdown of Livin suppresses cell proliferation and invasion and enhances the chemosensitivity to cisplatin in human osteosarcoma cells.
23563149 2013 Overexpression of the truncated form of Livin reveals a complex interaction with caspase-3.
23524337 2013 Livin promotes progression of breast cancer through induction of epithelial-mesenchymal transition and activation of AKT signaling.
23480510 2013 BRG1 promotes survival of UV-irradiated melanoma cells by cooperating with MITF to activate the melanoma inhibitor of apoptosis gene.
23404657 2013 Gene diagnosis of micrometastases in regional lymph nodes of patients with stage I non-small cell lung cancer: impact on staging and prognosis.
23343959 2013 Expression and prognostic significance of livin, caspase-3, and ki-67 in the progression of human ampullary carcinoma.
23188704 2013 Upregulation of the antiapoptotic factor Livin contributes to cisplatin resistance in colon cancer cells.
23069480 2013 Livin expression may be regulated by miR-198 in human prostate cancer cell lines.
23030305 2013 Expression of apoptosis associated proteins Survivin, Livin and Thrombospondin-1 in Burkitt lymphoma.
23029054 2012 Alteration of TEAD1 expression levels confers apoptotic resistance through the transcriptional up-regulation of Livin.
22938441 2012 Relationship between PTEN and Livin expression and malignancy of renal cell carcinomas.
22932199 2012 Expression of CD44v6 and Livin in gastric cancer tissue.
22931613 2012 [Effect of livin gene suppression by genistein on apoptosis, cell cycle and proliferation of malignant melanoma LiBr cells].
22930255 2013 Elevated levels of survivin and livin mRNA in bronchial aspirates as markers to support the diagnosis of lung cancer.
22902369 2012 BIRC7-E2 ubiquitin conjugate structure reveals the mechanism of ubiquitin transfer by a RING dimer.
22766624 2012 Expression and role of the inhibitor of apoptosis protein livin in chemotherapy sensitivity of ovarian carcinoma.
22711539 2012 Role of melanoma inhibitor of apoptosis (ML-IAP) protein, a member of the baculoviral IAP repeat (BIR) domain family, in the regulation of C-RAF kinase and cell migration.
22427141 2012 Livin mediates tumor cell invasion in the DU-145 cell line via NF-?B.
22086237 2012 siRNA directed against Livin inhibits tumor growth and induces apoptosis in human glioma cells.
22033581 2012 Immunity to the melanoma inhibitor of apoptosis protein (ML-IAP; livin) in patients with malignant melanoma.
21867615 2011 [Gene expression of livin and survivin in adult patients with acute lymphoblastic leukemia and its clinical significance].
21867610 2011 [Effects of bortezomib alone or combined with arsenic trioxide on the apoptosis of Jurkat cells and expression of livin mRNA].
21700335 2011 Expression of inhibitor of apoptosis protein (IAP) livin/BIRC7 in acute leukemia in adults: correlation with prognostic factors and outcome.
21617971 2011 Research progress on Livin protein: an inhibitor of apoptosis.
21122381 2010 [Expression and significance of JNK1, Raf-1 and Livin in the carcinogenesis of sporadic colorectal tubular adenoma].
20717925 2010 VEGF stimulation enhances Livin protein synthesis through mTOR signaling.
20691667 2010 Expression and functional role of inhibitor-of-apoptosis protein livin (BIRC7) in neuroblastoma.
20607788 2011 Livin-? promotes cell proliferation by regulating G1-S cell cycle transition in prostate cancer.
20584688 2010 [Expression of livin at the invasive tumor front of oral squamous cell carcinoma].
20460713 2010 Suppression of livin gene expression by siRNA leads to growth inhibition and apoptosis induction in human bladder cancer T24 cells.
20416174 2010 [Clinical significance of Livin expression in non-Hodgkin's lymphoma].
20388502 2010 Influence of Etoposide on anti-apoptotic and multidrug resistance-associated protein genes in CD133 positive U251 glioblastoma stem-like cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20109966 2010 Expression and prognostic significance of the apoptotic genes BCL2L13, Livin, and CASP8AP2 in childhood acute lymphoblastic leukemia.
19914791 2010 Expression of livin in gastric cancer and induction of apoptosis in SGC-7901 cells by shRNA-mediated silencing of livin gene.
19806913 2009 [Inhibitory effect of multiple siRNA recombinant expression vector targeting simultaneously Livin and Survivin genes on human colon cancer cells proliferation].
19724862 2009 MycN is a transcriptional regulator of livin in neuroblastoma.
19690982 2010 Livin abrogates apoptosis of SPC-A1 cell by regulating JNKI signaling pathway.
19635196 2009 [Expression and clinical significance of apoptosis associated genes Livin and Smac/DIABLO in human gastric carcinomas].
19549891 2009 The inhibitor of apoptosis protein Livin (ML-IAP) plays a dual role in tumorigenicity.
19397802 2009 Inhibitors of apoptosis proteins (IAPs) expression and their prognostic significance in hepatocellular carcinoma.
19074843 2008 Challenge and promise: roles for Livin in progression and therapy of cancer.
18837095 2008 Expression of livin and vascular endothelial growth factor in different clinical stages of human esophageal carcinoma.
18827979 2009 The effects on cell growth and chemosensitivity by livin RNAi in non-small cell lung cancer.
18555709 Livin may serve as a marker for prognosis of bladder cancer relapse and a target of bladder cancer treatment.
18515985 2008 Expression of splicing variants of the inhibitor of apoptosis livin in testicular germ cell tumors.
18476630 2008 [Expression of Livin in laryngeal squamous cell carcinoma and relationship with bFGF].
18451137 2008 Microphthalmia-associated transcription factor is a critical transcriptional regulator of melanoma inhibitor of apoptosis in melanomas.
18315896 2008 [Expression of anti-apoptosis livin gene in acute non-lymphocytic leukemia cells and its clinical significance].
18278467 2008 Expression and prognostic significance of Livin in the progression of bladder cancer.
18210873 2007 [Expression of livin in gastric cancer and effect of silencing of the livin gene on apoptosis in gastric cancer cells].
18034418 2007 Manipulation of NK cytotoxicity by the IAP family member Livin.
18031611 2007 Silencing livin gene by siRNA leads to apoptosis induction, cell cycle arrest, and proliferation inhibition in malignant melanoma LiBr cells.
17968430 2007 Expression of inhibitor of apoptosis protein Livin in renal cell carcinoma and non-tumorous adult kidney.
17672950 2007 [Expression and clinical significance of Survivin and Livin in DukesoB colorectal cancer].
17632732 2008 Livin and Bcl-2 expression in high-grade osteosarcoma.
17519534 2007 Expression of the apoptosis inhibitor livin in renal cell carcinomas: correlations with pathology and outcome.
17437058 2007 Targeted inhibition of Livin resensitizes renal cancer cells towards apoptosis.
17294084 2007 Subcellular localization determines the delicate balance between the anti- and pro-apoptotic activity of Livin.
17035597 2007 Down-regulation of inhibitor of apoptosis proteins by deguelin selectively induces apoptosis in breast cancer cells.
16990595 2007 Expression of Livin, an antiapoptotic protein, is an independent favorable prognostic factor in childhood acute lymphoblastic leukemia.
16965834 2006 The anti-apoptotic livin gene is an important determinant for the apoptotic resistance of non-small cell lung cancer cells.
16840203 2006 Expression of BIRC7 protein and mRNA in non-Hodgkin's lymphoma.
16806840 2006 Proteolytic cleavage of Livin (ML-IAP) in apoptotic melanoma cells potentially mediated by a non-canonical caspase.
16729033 2006 Livin promotes Smac/DIABLO degradation by ubiquitin-proteasome pathway.
16437214 2006 Isoform-specific silencing of the Livin gene by RNA interference defines Livin beta as key mediator of apoptosis inhibition in HeLa cells.
16026775 2005 Detection of autoantibodies to survivin and livin in sera from patients with breast cancer.
15541814 2004 Expression of survivin mRNA and livin mRNA in non-small-cell lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485396 2005 Engineering ML-IAP to produce an extraordinarily potent caspase 9 inhibitor: implications for Smac-dependent anti-apoptotic activity of ML-IAP.
15009721 2004 The melanoma inhibitor of apoptosis protein: a target for spontaneous cytotoxic T cell responses.
14614456 2003 Induction of apoptosis in tumor cells by siRNA-mediated silencing of the livin/ML-IAP/KIAP gene.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12846571 2003 Structure and function analysis of peptide antagonists of melanoma inhibitor of apoptosis (ML-IAP).
12488298 2003 Expression and prognostic significance of LIVIN, SURVIVIN and other apoptosis-related genes in the progression of superficial bladder cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11865055 2002 IAP suppression of apoptosis involves distinct mechanisms: the TAK1/JNK1 signaling cascade and caspase inhibition.
11801603 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11322947 2001 Two splicing variants of a new inhibitor of apoptosis gene with different biological properties and tissue distribution pattern.
11162435 2000 KIAP, a novel member of the inhibitor of apoptosis protein family.
11084335 2000 ML-IAP, a novel inhibitor of apoptosis that is preferentially expressed in human melanomas.
11024045 2001 Livin, a novel inhibitor of apoptosis protein family member.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.