Property Summary

NCBI Gene PubMed Count 142
PubMed Score 214.65
PubTator Score 163.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.3e-02
psoriasis -1.800 1.3e-04
posterior fossa group B ependymoma -1.200 1.9e-09
group 3 medulloblastoma -2.300 1.1e-04
atypical teratoid/rhabdoid tumor -2.800 1.5e-14
glioblastoma -1.100 4.0e-03
adrenocortical carcinoma -1.104 2.7e-02
fibroadenoma -1.300 1.8e-03
adult high grade glioma -1.300 2.2e-03
aldosterone-producing adenoma -1.116 4.7e-03
spina bifida 1.153 4.5e-02
ductal carcinoma in situ -1.600 7.4e-04
invasive ductal carcinoma -2.000 1.0e-03
ovarian cancer 1.400 1.7e-04

Gene RIF (87)

PMID Text
26833786 Data demonstrate that EHBP1L1 links Rab8 and the Bin1-dynamin complex, which generates membrane curvature and excises the vesicle at the endocytic recycling compartment for apical transport.
26738348 The frequencies of BIN1 alleles were similar in both control and Alzheimer patients showing o no association.
26733302 no association was found for either polymorphism, suggesting that these genes are not implicated in the aetiology of Alzheimer's disease in all populations.
26233692 Alterations in the BIN1 locus, previously associated with Alzheimer disease, may modify the age of onset of GBA-associated Parkinson.
26195312 In vitro studies in human Caco-2 cells showed that Bin1 antibody altered the expression of tight junction proteins and improved barrier function.
25957634 This study demonistrated that BIN1 mutation releated to Centronuclear myopathy.
25683635 Results show low expression of Bin1, along with high expression of IDO, are predictor for poor prognosis in esophageal squamous cell cancer and thereby could be used to establish new therapeutic strategies.
25630570 This study findings demonstrate that rs744373 itself or a variation in linkage disequilibrium may provide a neurogenetic mechanism for BIN.1
25578476 Reduced BIN1 expression is associated with cutaneous T-cell lymphoma.
25487648 BIN1/M-Amphiphysin2 has a role in inducing clustering of phosphoinositides to recruit its downstream partner dynamin
25461955 The study is the first to confirm the association of the variant rs7561528 adjacent to Bin1 with Sporadic Alzheimer's Disease in a Han Chinese Population.
25365775 Brain DNA methylation in BIN1 was associated with pathological Alzheimer disease.
25350771 These results suggest an autoinhibition model for BIN1 that involves a synergistic regulation by membrane composition and protein-protein interactions.
25262827 These results support a role for N-WASP in amphiphysin-2-dependent nuclear positioning and triad organization and in centronuclear myopathy and myotonic dystrophy pathophysiology.
25260562 specific amphiphysin 2 mutations can cause either recessive or dominant centronuclear myopathy and that both disorders involve different pathomechanisms
25257171 The release of BIN1 from hypo-poly(ADP-ribosyl)ated E2F1 is a mechanism by which serum starvation promotes E2F1-induced apoptosis.
25129075 Our analyses suggest that these DNA methylation changes may have a role in the onset of Alzheimer disease given that we observed them in presymptomatic subjects and that six of the validated genes connect to a known susceptibility gene network.
25051234 These findings suggest that an intracellular form CLU and BIN1 interaction might impact Tau function in neurons and uncover potential new mechanisms underlying the etiology of Tau pathology in in Alzheimer's disease.
25024306 Results suggest that BIN1 is likely involved in Alzheimer's disease as a modulator of neurofibrillary tangle pathology, and that this role may extend to other human diseases that feature tau pathology
25022885 BIN1 rs744373 polymorphism is significantly associated with late onset Alzheimer disease.
24755653 Two mutants of BIN1 showed impaired membrane tubulation both in vivo and in vitro, and displayed characteristically different behaviors.
24660791 physical activity attenuated the effects of genetic risk (ie. the constellation of PICALM, BIN1, and CLU polymorphisms) on episodic memory
24616074 The study compares the binding dynamics and affinities of the relevant regions for binding of c-Myc and NS5A to Bin1 SH3. The result gives further insights into the potential role of NS5A in Bin1-mediated apoptosis.
24590001 BIN1 downregulation is linked to cancer progression and also correlates with ventricular cardiomyopathy and arrhythmia preceding heart failure. Increased BIN1 expression is linked to increased susceptibility for late-onset Alzheimer's disease. [review]
24582639 It is the most important genetic susceptibility locus in late-onset Alzheimer's disease.
24205320 BIN1 is decreased in sporadic but not familial Alzheimer's disease or in aging
23871436 REVIEW--BIN1: form, function, and Alzheimer's disease
23803295 The resukts of this study highlight the possible use of plasma BIN1 as a biomarker for AD diagnosis.
23754947 Our data demonstrate that the alteration of the muscle-specific function of BIN1 is a common pathomechanism for centronuclear myopathy, myotonic dystrophy, and IMGD.
23570733 To our knowledge, this is the first study to show significant association between rs744373 polymorphism and AD in East Asian population.
23399914 BIN1 expression is increased in Alzheimer Disease brains when compared with controls.
23202439 We identified rare small events overlapping CR1 and BIN1 in Alzheimer's disease and normal controls with opposite copy number variation dosage.
22976291 Findings suggest that RIN1 orchestrates RAB5 activation, ABL kinase activation and BIN1 recruitment to determine EGFR fate.
22544318 The re-expression of BIN1 specifically compromises the proliferation of SNF5-deficient rhabdoid tumors cell lines.
22539578 The SNP genotype pattern at the BIN1 gene is associated with episodic memory.
22281836 BIN1 expression is significantly decreased in surgically excised hepatocellular carcinoma patient specimens as well as in HCC cell lines and decreased BIN1 expression correlates with the degree of differentiation of HCC and predicts poor prognosis.
21984944 Study showing the importance of Bin1 in the maintenance of intact t-tubule structure and ([Ca(2)]i) homeostasis in adult skeletal muscle could provide insight on the potential role of Bin1 in skeletal muscle contractility and pathology of myopathy.
21678469 Results suggest that the coiled-coil BIN1 BAR peptide encodes a novel BIN1 MID domain, through which BIN1 acts as a MYC-independent cancer suppressor.
21623381 alternative splicing associated with T tubule alterations and muscle weakness in myotonic dystrophy
21447796 A model has been proposed in which increased abundance of c-MYC indirectly leads to decreased BIN1 expression, in turn leading to increased PARP activity and resistance to DNA-damaging agents.
21379329 There was evidence of association for recently-reported late-onset Alzheimer's disease risk loci, including BIN1 and CLU and CUGBP2 with APOE.
21347408 variants in BIN1, CLU, CR1 or PICALM are associated with changes in the CSF levels of biomarkers
21321396 Logistic regression analysis successfully replicates the association of BIN1 (rs744373) with late-onset Alzheimer's disease, with an odds ratio comparable to that previously reported.
21220176 we confirmed that BIN1 is a genetic determinants of Alzheimer disease.
21129173 We present the first clinical description of intrafamilal variability in two first-degree cousins with a novel BIN1 stop mutation.
21059989 BIN1 polymorphisms were associated with late-onset Alzheimer disease in an independent cohort from the National Institute on Aging Late-Onset Alzheimer's Disease Family Study
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20927630 This study proposed that aberrant BIN1 localization and defects in triad structure are part of a common pathogenetic mechanism shared between the three forms of centronuclear myopathies.
20558387 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20558387 This study shown that established and candidate AD genes have a role in 6 neuroimaging traits linked to AD. 2 promising genes from Alzheimer disease GWASs, CNTN5 and BIN1, are associated with these neuroimaging measures.
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20169111 Data have identified that membrane-associated BIN1 not only induces membrane curvature but can direct specific antegrade delivery of microtubule-transported membrane proteins.
20142620 BIN1 sequencing revealed a homozygous missense mutation in a patient with recessive centronuclear myopathy
20140253 Characterization of amphiphysin 2 membrane tubules in cultured cells with correlative light-electron microscopy
19915558 show a requirement for human BIN1 (also known as Amphiphysin 2) in EHD1-regulated endocytic recycling.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19629135 BIN1 is transcriptionally activated by E2F1 and mediates E2F1-induced apoptosis in response to DNA damage.
19418541 Bin1 appears to function as a metastasis suppressor and chemosensitizer in neuroblastoma.
19004523 Amphiphysin 2/BIN1 participates in the tubulation of traffic intermediates and intracellular organelles first via its intrinsic tubulating potential and second via its ability to bind CLIP-170 and microtubules.
18817572 REVIEW : BIN1 mutations and centronuclear myopathy
18658220 findings support models for membrane curving by BAR domains in which helix-0 increases the binding affinity to the membrane and enhances curvature generation
18348166 Results suggest that Bin1 gene suppression caused by oncogenic E1A via Rb/E2F1 inactivation is an essential step in cell cycle progression promoted by c-Myc, and subsequently, E1A transformation.
18154705 Mutated in recessive centronuclear myopathies.
17699764 Mosaic knockout mice lacking Bin1 exhibit lung and liver cancer, increased inflammation or premalignant lesions in prostate, and more progressive colon cancer. Thus, Bin1 suppresses inflammation and cancer during aging.
17676042 Results suggest that mutations in BIN1 cause centronuclear myopathy by interfering with remodeling of T tubules and/or endocytic membranes, and that the interaction between BIN1 and DNM2 is necessary for normal muscle function and positioning of nuclei.
17676042 Mutations in amphiphysin 2 (BIN1) disrupt its membrane tubulation properties and its interaction with dynamin 2, and cause autosomal recessive centronuclear myopathy
17671430 potential relevance of Bin1-Ku interaction to cancer are discussed in light of these findings
17611416 hob1+, the fission yeast homolog of Bin1, supports a mechanism of Rad6/Set1-dependent transcriptional repression that may relate to cancer suppression by Bin1.
17218774 Bin1 gene encodes a protein that suppresses neoplastic cell transformation.Bin1 may be a clinical prognostic marker in breast cancer.
17218774 Immunohistochemical losses of nuclear Bin1 proteins in cases of human breast cancer were associated with increased progression status and poor prognosis.
17210688 Mammary specific deletion of the Bin1 gene cooperates with ras activation to drive mammary tumor progression. The findings establish a role for Bin1 as a negative modifier of oncogenicity and progression in breast cancer.
17059209 Crystal structure shows that both the quaternary and tertiary architectures of the homodimeric Bin1 BAR domain are built upon "knobs-into-holes" packing of side chains, and this packing governs the curvature of a putative membrane-engaging concave face.
16516635 combination of gene dosages of MYCN and Survivin and the expression level of BIN1 using the quantitative polymerase chain reaction method was significantly correlated with the clinical stage and the patients' outcome in neuroblastoma
15992821 tumor-specific isoforms of Bin1 are precluded from interaction with c-Myc through an intramolecular polyproline-SH3 domain interaction. Furthermore, c-Myc/Bin1 interaction can be inhibited by phosphorylation of c-Myc at Ser62.
15483625 Phosphoinositides regulate BIN1 SH3 domain binding.
14704274 role in activating various target genes after induction with the microtubule disrupting agent T113242
12773571 Studies in mouse indicate that Bin1 is dispensable for endocytosis but essential for appropriate cardiac development.
12668730 Sorting nexin 4 and amphiphysin 2 have roles in endocytosis and intracellular trafficking
12532338 Results document the extent of expression of nuclear Bin1 isoforms, which exhibit cancer suppression and proapoptotic activity in human cells.
12183633 findings support a role of the bilayer-deforming properties of amphiphysin at T-tubules and, more generally, a physiological role of amphiphysin in membrane deformation
10738240 There is frequent loss or downregulation of Bin1 in metastatic prostate cancer.
10652430 There is frequent downregulation of Bin1 in malignant breast cells; ectopic Bin1 activates PCD in cells lacking expression.
10449755 Missplicing of a brain-specific exon of Bin1 in human melanoma is sufficient to abolish tumor suppressor properties; ectopic WT Bin1 activates PCD in malignant but not normal melanocytes.
9418903 Bin1 plays a crucial role in terminal differentiation of myoblasts; associated with induction of a muscle-specific splice isoform and subcellular relocalization.
9395479 Several tissue-specific splice isoforms of the human Bin1 gene are found only in brain or muscle.
8782822 A nucleocytosolic myc-interacting isoform of Bin1 has properties of a tumor suppressor.

AA Sequence

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLA      1 - 70
SVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRI     71 - 140
AKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELI    141 - 210
KAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT    211 - 280
VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPS    281 - 350
KEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLW    351 - 420
EPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSL    421 - 490
PAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDE    491 - 560
GWLMGVKESDWNQHKELEKCRGVFPENFTERVP                                         561 - 593
//

Text Mined References (152)

PMID Year Title
26833786 2016 EHBP1L1 coordinates Rab8 and Bin1 to regulate apical-directed transport in polarized epithelial cells.
26738348 2015 Potential genetic biomarkers in the early diagnosis of Alzheimer disease: APOE and BIN1.
26733302 2016 Association study of the BIN1 and IL-6 genes on Alzheimer's disease.
26506308 2015 Amphiphysin 2 Orchestrates Nucleus Positioning and Shape by Linking the Nuclear Envelope to the Actin and Microtubule Cytoskeleton.
26233692 2015 The Alzheimer disease BIN1 locus as a modifier of GBA-associated Parkinson disease.
26195312 2016 Novel Colitis Immunotherapy Targets Bin1 and Improves Colon Cell Barrier Function.
25957634 2015 Centronuclear myopathies: genotype-phenotype correlation and frequency of defined genetic forms in an Italian cohort.
25683635 2015 Low expression of Bin1, along with high expression of IDO in tumor tissue and draining lymph nodes, are predictors of poor prognosis for esophageal squamous cell cancer patients.
25630570 2015 Bridging Integrator 1 (BIN1) Genotype Effects on Working Memory, Hippocampal Volume, and Functional Connectivity in Young Healthy Individuals.
25578476 2015 BIN1 tumor suppressor regulates Fas/Fas ligand-mediated apoptosis through c-FLIP in cutaneous T-cell lymphoma.
25487648 2014 BIN1/M-Amphiphysin2 induces clustering of phosphoinositides to recruit its downstream partner dynamin.
25461955 2015 Common variants at Bin1 are associated with sporadic Alzheimer's disease in the Han Chinese population.
25365775 2015 Association of Brain DNA methylation in SORL1, ABCA7, HLA-DRB5, SLC24A4, and BIN1 with pathological diagnosis of Alzheimer disease.
25350771 2014 BIN1 membrane curvature sensing and generation show autoinhibition regulated by downstream ligands and PI(4,5)P2.
25262827 2014 N-WASP is required for Amphiphysin-2/BIN1-dependent nuclear positioning and triad organization in skeletal muscle and is involved in the pathophysiology of centronuclear myopathy.
25260562 2014 Adult-onset autosomal dominant centronuclear myopathy due to BIN1 mutations.
25257171 2015 Regulation of E2F1-induced apoptosis by poly(ADP-ribosyl)ation.
25129075 2014 Alzheimer's disease: early alterations in brain DNA methylation at ANK1, BIN1, RHBDF2 and other loci.
25051234 2014 Intracellular clusterin interacts with brain isoforms of the bridging integrator 1 and with the microtubule-associated protein Tau in Alzheimer's disease.
25024306 2014 Bridging integrator 1 (BIN1) protein expression increases in the Alzheimer's disease brain and correlates with neurofibrillary tangle pathology.
25022885 2014 Genetic evidence for the involvement of variants at APOE, BIN1, CR1, and PICALM loci in risk of late-onset Alzheimer's disease and evaluation for interactions with APOE genotypes.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24755653 2014 Mutations in BIN1 associated with centronuclear myopathy disrupt membrane remodeling by affecting protein density and oligomerization.
24660791 2014 The benefits of staying active in old age: physical activity counteracts the negative influence of PICALM, BIN1, and CLU risk alleles on episodic memory functioning.
24616074 2014 Hepatitis C virus NS5A is able to competitively displace c-Myc from the Bin1 SH3 domain in vitro.
24590001 2014 Amphiphysin 2 (BIN1) in physiology and diseases.
24582639 2014 Genetic variation in BIN1 gene and Alzheimer's disease risk in Han Chinese individuals.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205320 2013 BIN1 is decreased in sporadic but not familial Alzheimer's disease or in aging.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23917616 2013 The myotubularin-amphiphysin 2 complex in membrane tubulation and centronuclear myopathies.
23871436 2013 Bridging integrator 1 (BIN1): form, function, and Alzheimer's disease.
23803295 2013 Exploring the value of plasma BIN1 as a potential biomarker for alzheimer's disease.
23754947 2013 Altered splicing of the BIN1 muscle-specific exon in humans and dogs with highly progressive centronuclear myopathy.
23570733 2013 BIN1 gene rs744373 polymorphism contributes to Alzheimer's disease in East Asian population.
23399914 2013 Increased expression of BIN1 mediates Alzheimer genetic risk by modulating tau pathology.
23202439 2013 Genome-wide scan for copy number variation association with age at onset of Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22976291 2012 RIN1 orchestrates the activation of RAB5 GTPases and ABL tyrosine kinases to determine the fate of EGFR.
22832961 2012 Genome-wide association study of Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22544318 2012 Epigenetic inactivation of the tumor suppressor BIN1 drives proliferation of SNF5-deficient tumors.
22539578 2012 Genotype patterns at PICALM, CR1, BIN1, CLU, and APOE genes are associated with episodic memory.
22281836 2012 Characterization of bridging integrator 1 (BIN1) as a potential tumor suppressor and prognostic marker in hepatocellular carcinoma.
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
21984944 2011 Disrupted membrane structure and intracellular Ca²? signaling in adult skeletal muscle with acute knockdown of Bin1.
21678469 2011 Identification of a novel effector domain of BIN1 for cancer suppression.
21627779 2011 The membrane-spanning 4-domains, subfamily A (MS4A) gene cluster contains a common variant associated with Alzheimer's disease.
21623381 2011 Misregulated alternative splicing of BIN1 is associated with T tubule alterations and muscle weakness in myotonic dystrophy.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21460840 2011 Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.
21447796 2011 MYC, PARP1, and chemoresistance: BIN there, done that?
21390209 2011 Meta-analysis for genome-wide association study identifies multiple variants at the BIN1 locus associated with late-onset Alzheimer's disease.
21379329 2011 Genome-wide association of familial late-onset Alzheimer's disease replicates BIN1 and CLU and nominates CUGBP2 in interaction with APOE.
21347408 2011 Fine mapping of genetic variants in BIN1, CLU, CR1 and PICALM for association with cerebrospinal fluid biomarkers for Alzheimer's disease.
21321396 2011 Replication of BIN1 association with Alzheimer's disease and evaluation of genetic interactions.
21220176 2011 Evidence of the association of BIN1 and PICALM with the AD risk in contrasting European populations.
21129173 2010 Case report of intrafamilial variability in autosomal recessive centronuclear myopathy associated to a novel BIN1 stop mutation.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
20927630 2011 Defects in amphiphysin 2 (BIN1) and triads in several forms of centronuclear myopathies.
20558387 2010 Genetic variation and neuroimaging measures in Alzheimer disease.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20169111 2010 BIN1 localizes the L-type calcium channel to cardiac T-tubules.
20142620 2010 Phenotype of a patient with recessive centronuclear myopathy and a novel BIN1 mutation.
20140253 2010 From dynamic live cell imaging to 3D ultrastructure: novel integrated methods for high pressure freezing and correlative light-electron microscopy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19915558 2009 AMPH-1/Amphiphysin/Bin1 functions with RME-1/Ehd1 in endocytic recycling.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19629135 2009 The c-MYC-interacting proapoptotic tumor suppressor BIN1 is a transcriptional target for E2F1 in response to DNA damage.
19418541 2009 Bin1 is linked to metastatic potential and chemosensitivity in neuroblastoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19004523 2009 The membrane-tubulating potential of amphiphysin 2/BIN1 is dependent on the microtubule-binding cytoplasmic linker protein 170 (CLIP-170).
18985028 2008 Hepatitis C virus infection protein network.
18817572 2008 Centronuclear (myotubular) myopathy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18658220 2008 Structure and dynamics of helix-0 of the N-BAR domain in lipid micelles and bilayers.
18647389 2008 The central proline rich region of POB1/REPS2 plays a regulatory role in epidermal growth factor receptor endocytosis by binding to 14-3-3 and SH3 domain-containing proteins.
18348166 2008 Adenovirus E1A oncoprotein liberates c-Myc activity to promote cell proliferation through abating Bin1 expression via an Rb/E2F1-dependent mechanism.
18154705 2007 [Mutations in amphiphysin 2 (BIN1) cause autosomal recessive centronuclear myopathy].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17699764 2007 Bin1 ablation increases susceptibility to cancer during aging, particularly lung cancer.
17676042 2007 Mutations in amphiphysin 2 (BIN1) disrupt interaction with dynamin 2 and cause autosomal recessive centronuclear myopathy.
17671430 2007 Bin1 interacts with and restrains the DNA end-binding protein complex Ku.
17611416 2007 Bin1 homolog hob1 supports a Rad6-Set1 pathway of transcriptional repression in fission yeast.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17218774 2007 Bin1 attenuation in breast cancer is correlated to nodal metastasis and reduced survival.
17210688 2007 Bin1 ablation in mammary gland delays tissue remodeling and drives cancer progression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17059209 2006 The crystal structure of the BAR domain from human Bin1/amphiphysin II and its implications for molecular recognition.
16530520 2006 The SH3 binding motif of HCV [corrected] NS5A protein interacts with Bin1 and is important for apoptosis and infectivity.
16516635 2006 Biological diagnosis for neuroblastoma using the combination of highly sensitive analysis of prognostic factors.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
16115810 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways.
15992821 2005 A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15483625 2004 Regulation of Bin1 SH3 domain binding by phosphoinositides.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14704274 2004 Myc-interacting protein 1 target gene profile: a link to microtubules, extracellular signal-regulated kinase, and cell growth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972505 2003 RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway.
12773571 2003 Targeted disruption of the murine Bin1/Amphiphysin II gene does not disable endocytosis but results in embryonic cardiomyopathy with aberrant myofibril formation.
12668730 2003 Sorting nexin 4 and amphiphysin 2, a new partnership between endocytosis and intracellular trafficking.
12604805 2003 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein.
12558988 2003 Specific interactions of neuronal focal adhesion kinase isoforms with Src kinases and amphiphysin.
12532338 2003 Immunohistochemical analysis of Bin1/Amphiphysin II in human tissues: diverse sites of nuclear expression and losses in prostate cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456676 2003 Characterization of Endophilin B1b, a brain-specific membrane-associated lysophosphatidic acid acyl transferase with properties distinct from endophilin A1.
12183633 2002 Amphiphysin 2 (Bin1) and T-tubule biogenesis in muscle.
11709703 2001 Amphiphysin IIb-1, a novel splicing variant of amphiphysin II, regulates p73beta function through protein-protein interactions.
11422041 2001 Pattern of expression of c-Myc, Max and Bin1 in human anagen hair follicles.
11384986 2001 Endophilin regulates JNK activation through its interaction with the germinal center kinase-like kinase.
11306501 2001 Bin1 mediates apoptosis by c-Myc in transformed primary cells.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11032017 2000 The c-Myc-interacting adaptor protein Bin1 activates a caspase-independent cell death program.
10903846 2000 Bin2, a functionally nonredundant member of the BAR adaptor gene family.
10899172 2000 Specificity of the binding of synapsin I to Src homology 3 domains.
10764771 2000 Inhibition of phospholipase D by amphiphysins.
10652430 2000 Losses of the tumor suppressor BIN1 in breast carcinoma are frequent and reflect deficits in programmed cell death capacity.
10430869 1999 Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
10412034 1999 Induction of apoptosis and differentiation in neuroblastoma and astrocytoma cells by the overexpression of Bin1, a novel Myc interacting protein.
10391921 1999 The N terminus of amphiphysin II mediates dimerization and plasma membrane targeting.
10094488 1999 Identification of novel interaction partners for the conserved membrane proximal region of alpha-integrin cytoplasmic domains.
10036185 1999 The murine Bin1 gene functions early in myogenesis and defines a new region of synteny between mouse chromosome 18 and human chromosome 2.
9603201 1998 Multiple amphiphysin II splice variants display differential clathrin binding: identification of two distinct clathrin-binding sites.
9418903 1998 A role for the putative tumor suppressor Bin1 in muscle cell differentiation.
9395479 1997 Structural analysis of the human BIN1 gene. Evidence for tissue-specific transcriptional regulation and alternate RNA splicing.
9356459 1997 The amphiphysin-like protein 1 (ALP1) interacts functionally with the cABL tyrosine kinase and may play a role in cytoskeletal regulation.
9348539 1997 Amphiphysin heterodimers: potential role in clathrin-mediated endocytosis.
9341169 1997 Synaptojanin forms two separate complexes in the nerve terminal. Interactions with endophilin and amphiphysin.
9315708 1997 SH3 domain-dependent interactions of endophilin with amphiphysin.
9280305 1997 Clathrin interacts specifically with amphiphysin and is displaced by dynamin.
9223448 1997 cDNA cloning of a novel amphiphysin isoform and tissue-specific expression of its multiple splice variants.
9195986 1997 Identification and characterization of a nerve terminal-enriched amphiphysin isoform.
9182667 1997 Amphiphysin II (SH3P9; BIN1), a member of the amphiphysin/Rvs family, is concentrated in the cortical cytomatrix of axon initial segments and nodes of ranvier in brain and around T tubules in skeletal muscle.
9182529 1997 A new member of the amphiphysin family connecting endocytosis and signal transduction pathways.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8782822 1996 BIN1 is a novel MYC-interacting protein with features of a tumour suppressor.
8725406 1996 The Bin1 gene localizes to human chromosome 2q14 by PCR analysis of somatic cell hybrids and fluorescence in situ hybridization.
8619474 1996 A "double adaptor" method for improved shotgun library construction.