Property Summary

NCBI Gene PubMed Count 66
PubMed Score 123.36
PubTator Score 117.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 2.100 9.7e-09
non-small cell lung cancer 1.818 1.5e-13
intraductal papillary-mucinous adenoma (... 1.300 5.0e-05
intraductal papillary-mucinous carcinoma... 1.100 2.4e-03
intraductal papillary-mucinous neoplasm ... 2.200 2.4e-04
lung cancer 2.000 7.7e-04
breast carcinoma 1.200 3.1e-04
pancreatic carcinoma 1.300 2.8e-02
lung adenocarcinoma 1.600 1.7e-06
ductal carcinoma in situ 2.400 1.1e-03
invasive ductal carcinoma 2.800 3.6e-05
ovarian cancer 1.600 1.1e-06
psoriasis 1.400 3.2e-44

 GWAS Trait (1)

Gene RIF (42)

PMID Text
25861752 our data demonstrated that suppression of BIK in ER-positive MCF-7 cells prevents the cytotoxic effect of TAM and favors a more aggressive phenotype, due to the molecular change of different pathways
25463603 HCV RNA replication and release were significantly suppressed in BIK-depleted cells and over-expression of the RNA-dependent RNA polymerase, NS5B, was able to induce BIK expression
25002530 Findings identify novel cross talk between autophagy and apoptosis, wherein targeting SQSTM1/p62 converts cytoprotective autophagy to an inefficient form due to cargo loading failure, leading to NBK/Bik accumulation, which triggers apoptosis.
24637719 BikDDA, a novel mutant of Bik, showed a prolonged half-life and enhanced pro-apoptotic ability in triple-negative breast cancer cells compared with BikDD.
24554662 Authors show that human herpesvirus 4 EBNA2 represses BIK in B-cell lymphoma-derived cell lines and that this host-virus interaction can inhibit the proapoptotic effect of transforming growth factor beta1.
24527759 Data suggest BIK expression in tumor cells is not subject to direct regulation by MAP kinase signaling; BIK expression appears to be cell-cycle-dependent and increases in G1 cell-cycle arrest which results from inhibition of MAP kinase signaling.
22873408 A previously undescribed indirect epigenetic regulation of BIK in FA-C lymphoblasts is mediated by DeltaNp73, an isoform of p73 lacking its transactivation domain that activates BIK through a proximal element in its promoter.
22855140 BIK/NBK gene expression may have important clinical implications and provide predictive, prognostic or therapeutic marker in breast cancer patients
22388352 Src tyrosine kinase inhibits apoptosis through the Erk1/2- dependent degradation of the death accelerator Bik.
22288719 Data indicate that methylation-induced transcriptional silencing of the BIK (bcl2-interacting killer) pro-apoptotic gene may occur in multiple myeloma (MM), which might serve as a predictor of the development of relapsed/refractory MM.
22139380 Data show that association of study-wide significance (P < 8.2 x 10(-5)) was identified for single-nucleotide polymorphisms (SNP) in TP53, LIG1, and BIK.
21622563 GRP78 can decrease BCL-2 sequestration by BIK at the endoplasmic reticulum
21063407 Bik has a role in both, apoptosis induction and sensitivity to oxidative stress in myeloma cells.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898928 genetic polymorphism in patients with ataxia telangiectasia is associated with the disease progression
19898928 Observational study of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19641504 BIK is mainly localized in the ER & induces apoptosis through the mitochondrial pathway. It is involved in mature B cell selection. It a pro-apoptotic tumor suppressor in several human tissues. Review.
19632297 BIK might not play a major role in the susceptibility of schizophrenia in Japanese population.
19632297 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18299962 The depletion of ER Ca2+ stores rather than the elevation of cytosolic Ca2+ or the extracellular Ca2+ entry contributed to Bik-induced Hep3B cells apoptosis.
17714764 Genes encoding KU70, MGST1 and BIK show age-related mRNA expression levels in hematopoietic stem cells.
17574210 The activation of caspase-9 and depolarization of mitochondrial membrane potential were induced by BIK, which were decreased concomitant with caspase-12 silenced.
17047080 Results suggest that expression of BIK in human breast cancer cells is regulated at the mRNA level by a mechanism involving a nontranscriptional activity of p53 and by proteasomal degradation of BIK protein.
17027756 E2Fs transactivate bik by a p53-independent mechanism.
16060964 Bik does not have a definitive role in development and progression of sporadic breast neoplasms in Mexican females
15824729 Bik/NBK accumulation was caused by stabilization of the protein from degradation and was associated with bortezomib cytotoxicity and apoptosis induction.
15809295 Endogenous cellular BIK, therefore, regulates a BAX,BAK-dependent ER pathway that contributes to mitochondrial apoptosis
15791210 Data show that BIK activates recruitment of DRP1 to the surface of the endoplasmic reticulum in intact cells, resulting in mitochondrial fragmentation but little release of cytochrome c to the cytosol.
15767553 Bik and Bim have roles in bortezomib sensitization of cells to killing by death receptor ligand TRAIL
15731089 degraded in Chlamydia trachomatis-infected cells.
14983013 Bik is induced in MCF-7 cells in the absence of estrogen signaling and plays a critical role in the antiestrogen-provoked breast cancer cell apoptosis.
12874789 Several sequence alterations of the BIK gene have been identified in peripheral B-cell lymphomas which may have a role in disease pathogenesis.
12853473 NBK mediates apoptosis entirely by BAX-dependent mitochondrial pathway.
11884414 The results identify BIK as an initiator of cytochrome c release from mitochondria operating from a location at the ER.
11782349 Systemic tumor suppression by the proapoptotic gene bik.

AA Sequence

MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDV      1 - 70
SLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLAL     71 - 140
LLLLALLLPLLSGGLHLLLK                                                      141 - 160
//

Text Mined References (66)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25861752 2015 Involvement of multiple cellular pathways in regulating resistance to tamoxifen in BIK-suppressed MCF-7 cells.
25463603 2015 NS5B induces up-regulation of the BH3-only protein, BIK, essential for the hepatitis C virus RNA replication and viral release.
25416956 2014 A proteome-scale map of the human interactome network.
25002530 2014 Targeting SQSTM1/p62 induces cargo loading failure and converts autophagy to apoptosis via NBK/Bik.
24637719 2014 BikDDA, a mutant of Bik with longer half-life expression protein, can be a novel therapeutic gene for triple-negative breast cancer.
24554662 2014 Repression of the proapoptotic cellular BIK/NBK gene by Epstein-Barr virus antagonizes transforming growth factor ?1-induced B-cell apoptosis.
24527759 2014 The increase in BIK expression following ERK1/2 pathway inhibition is a consequence of G? cell-cycle arrest and not a direct effect on BIK protein stability.
22873408 2012 BIK (NBK) is a mediator of the sensitivity of Fanconi anaemia group C lymphoblastoid cell lines to interstrand DNA cross-linking agents.
22855140 2012 BIK/NBK gene as potential marker of prognostic and therapeutic target in breast cancer patients.
22388352 2012 Src tyrosine kinase inhibits apoptosis through the Erk1/2- dependent degradation of the death accelerator Bik.
22288719 2012 Bcl2-interacting killer CpG methylation in multiple myeloma: a potential predictor of relapsed/refractory disease with therapeutic implications.
22139380 2012 Genetic determinants for promoter hypermethylation in the lungs of smokers: a candidate gene-based study.
21743057 2011 Genome-wide association study identifies new prostate cancer susceptibility loci.
21622563 2011 Novel mechanism of anti-apoptotic function of 78-kDa glucose-regulated protein (GRP78): endocrine resistance factor in breast cancer, through release of B-cell lymphoma 2 (BCL-2) from BCL-2-interacting killer (BIK).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21063407 2010 BH3-only protein Bik is involved in both apoptosis induction and sensitivity to oxidative stress in multiple myeloma.
21041309 2011 BH3 domains other than Bim and Bid can directly activate Bax/Bak.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20010695 2010 Antagonism of Beclin 1-dependent autophagy by BCL-2 at the endoplasmic reticulum requires NAF-1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898928 2010 BAK, BAX, and NBK/BIK proapoptotic gene alterations in Iranian patients with ataxia telangiectasia.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19641504 2008 BIK, the founding member of the BH3-only family proteins: mechanisms of cell death and role in cancer and pathogenic processes.
19632297 2009 No association between the Bcl2-interacting killer (BIK) gene and schizophrenia.
18953687 2008 A novel member of the Rhomboid family, RHBDD1, regulates BIK-mediated apoptosis.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18299962 2008 The endoplasmic reticulum (ER)-target protein Bik induces Hep3B cells apoptosis by the depletion of the ER Ca2+ stores.
17714764 2007 Age-related transcription levels of KU70, MGST1 and BIK in CD34+ hematopoietic stem and progenitor cells.
17574210 2007 Apoptosis induced by BIK was decreased with RNA interference of caspase-12.
17289999 2007 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.
17047080 2006 Regulation of expression of BIK proapoptotic protein in human breast cancer cells: p53-dependent induction of BIK mRNA by fulvestrant and proteasomal degradation of BIK protein.
17027756 2006 Transcriptional activation of the proapoptotic bik gene by E2F proteins in cancer cells.
16697956 2006 Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16060964 2005 A molecular analysis by gene expression profiling reveals Bik/NBK overexpression in sporadic breast tumor samples of Mexican females.
15824729 2005 Bik/NBK accumulation correlates with apoptosis-induction by bortezomib (PS-341, Velcade) and other proteasome inhibitors.
15809295 2005 BH3-only BIK regulates BAX,BAK-dependent release of Ca2+ from endoplasmic reticulum stores and mitochondrial apoptosis during stress-induced cell death.
15791210 2005 Endoplasmic reticulum BIK initiates DRP1-regulated remodelling of mitochondrial cristae during apoptosis.
15767553 2005 The proteasome inhibitor bortezomib sensitizes cells to killing by death receptor ligand TRAIL via BH3-only proteins Bik and Bim.
15731089 2005 Degradation of the proapoptotic proteins Bik, Puma, and Bim with Bcl-2 domain 3 homology in Chlamydia trachomatis-infected cells.
15694340 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14983013 2004 The Bik BH3-only protein is induced in estrogen-starved and antiestrogen-exposed breast cancer cells and provokes apoptosis.
12874789 2003 Mutations of the BIK gene in human peripheral B-cell lymphomas.
12853473 2003 Induction of cell death by the BH3-only Bcl-2 homolog Nbk/Bik is mediated by an entirely Bax-dependent mitochondrial pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11375329 2001 High glucose causes apoptosis in cultured human pancreatic islets of Langerhans: a potential role for regulation of specific Bcl family genes toward an apoptotic cell death program.
11342619 2001 Involvement of Bik, a proapoptotic member of the Bcl-2 family, in surface IgM-mediated B cell apoptosis.
10974546 2000 Structural analysis of the human pro-apoptotic gene Bik: chromosomal localization, genomic organization and localization of promoter sequences.
10591208 1999 The DNA sequence of human chromosome 22.
10500065 1999 Mapping of a target region of allelic loss to a 0.5-cM interval on chromosome 22q13 in human colorectal cancer.
10381646 1999 Survival activity of Bcl-2 homologs Bcl-w and A1 only partially correlates with their ability to bind pro-apoptotic family members.
10381623 1999 A novel adenovirus E1B19K-binding protein B5 inhibits apoptosis induced by Nip3 by forming a heterodimer through the C-terminal hydrophobic region.
9525867 1998 Blk, a BH3-containing mouse protein that interacts with Bcl-2 and Bcl-xL, is a potent death agonist.
9463381 1998 The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for inhibition of apoptosis and interaction with CED-4.
8816500 1996 Induction of apoptosis by human Nbk/Bik, a BH3-containing protein that interacts with E1B 19K.
8521816 1995 A conserved domain in Bak, distinct from BH1 and BH2, mediates cell death and protein binding functions.
7478623 1995 Bik, a novel death-inducing protein shares a distinct sequence motif with Bcl-2 family proteins and interacts with viral and cellular survival-promoting proteins.