Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.95
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.042 1.3e-02
adult high grade glioma -2.000 2.5e-05
Astrocytoma, Pilocytic -2.300 6.2e-10
atypical teratoid / rhabdoid tumor -2.300 1.9e-07
Breast cancer 1.500 6.1e-13
ependymoma -2.400 5.8e-17
glioblastoma -1.900 2.1e-09
group 4 medulloblastoma -1.100 7.3e-03
intraductal papillary-mucinous adenoma (... 1.400 5.5e-04
intraductal papillary-mucinous carcinoma... 1.200 4.9e-04
intraductal papillary-mucinous neoplasm ... 1.400 4.7e-04
invasive ductal carcinoma 1.300 4.1e-04
lung carcinoma 1.300 5.1e-23
medulloblastoma, large-cell -1.500 5.0e-04
osteosarcoma -1.188 1.9e-04
ovarian cancer -3.500 4.0e-15
pituitary cancer -1.300 2.2e-04
primitive neuroectodermal tumor -1.400 1.1e-02
spina bifida -1.135 4.7e-02

Gene RIF (2)

AA Sequence

MSAFCLGLVGRASAPAEPDSACCMELPAAAGDAVRSPAAAAALIFPGGSGELELALEEELALLAAGERPS      1 - 70
DPGEHPQAEPGSLAEGAGPQPPPSQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTD     71 - 140
KLEHLEQEKHELRRRFENREGEWEGRVSELESDVKQLQDELERQQIHLREADREKSRAVQELSEQNQRLL    141 - 210
DQLSRASEVERQLSMQVHALREDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQ    211 - 280
GTVEELQDRVLILERQGHDKDLQLHQSQLELQEVRLSCRQLQVKVEELTEERSLQSSAATSTSLLSEIEQ    281 - 350
SMEAEELEQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALN    351 - 420
ELKRLIQSIVDGMEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAK    421 - 490
CRMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKERSQPAAALCRGHSAGRGDEPSI    491 - 560
AEGKRLFSFFRKI                                                             561 - 573
//

Text Mined References (7)

PMID Year Title