Property Summary

NCBI Gene PubMed Count 27
PubMed Score 23.91
PubTator Score 20.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -1.900 1.8e-02
osteosarcoma 2.662 3.2e-08
astrocytoma 1.100 6.4e-03
medulloblastoma, large-cell -1.100 1.4e-04
spina bifida -1.174 2.4e-02
ovarian cancer 2.200 8.9e-05
dermatomyositis 1.100 3.6e-04

 GO Function (1)

Gene RIF (10)

PMID Text
25962623 several analyses of vesicular transport demonstrated that Rab6A and BICD2 play crucial roles in Golgi tubule fusion with the endoplasmic reticulum (ER) in brefeldin A (BFA)-treated cells
25497877 the features of BICD2 spinal muscular atrophy, lower extremity predominant are consistent with a pathological process that preferentially affects lumbar lower motor neurons
24507884 This study identified BICD3 significantly associated loci with a biologically plausible role in schizophrenia.
23664120 Disease causing mutations resulting in amino acid substitutions in two binding regions of BICD2 increase its binding affinity for the cytoplasmic dynein-dynactin complex.
23664119 BICD2 mutations cause non-5q linked spinal muscular atrophy in humans
23664116 Mutations in BICD2 cause congenital autosomal-dominant spinal muscular atrophy and massive Golgi fragmentation in affected cells.
23097494 Data suggest that ASUN promotes perinuclear enrichment of dynein at G2/M that facilitates BICD2- and CENP-F-mediated anchoring of dynein to nuclear pore complexes.
22190034 HIV-1 PR is identified to have a physical interaction with bicaudal D homolog 2 (BICD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18976975 Knockdown of bicaudal D homolog 2 (BICD2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
11864968 isolation, cloning, and characterization of human Nek8, a new mammalian NIMA-related kinase, and its candidate substrate Bicd2

AA Sequence

MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEA      1 - 70
IRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENE     71 - 140
RLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKH    141 - 210
EIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSL    211 - 280
DGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQ    281 - 350
QLMQMEREKAGLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHE    351 - 420
DGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKVSLLEK    421 - 490
ASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREG    491 - 560
QGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADGGTGDSSPSPGSSLPSPLSDPRREPMNIYNL    561 - 630
IAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKAN    631 - 700
KQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAA    701 - 770
AEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRAKAAPKTKPATPSL                    771 - 824
//

Text Mined References (38)

PMID Year Title
25962623 2015 Reconstitution of the targeting of Rab6A to the Golgi apparatus in semi-intact HeLa cells: A role of BICD2 in stabilizing Rab6A on Golgi membranes and a concerted role of Rab6A/BICD2 interactions in Golgi-to-ER retrograde transport.
25512093 2015 Novel mutations in the DYNC1H1 tail domain refine the genetic and clinical spectrum of dyneinopathies.
25497877 2015 Phenotypic and molecular insights into spinal muscular atrophy due to mutations in BICD2.
24507884 2014 Combined analysis of exon splicing and genome wide polymorphism data predict schizophrenia risk loci.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23664120 2013 Mutations in BICD2 cause dominant congenital spinal muscular atrophy and hereditary spastic paraplegia.
23664119 2013 Molecular defects in the motor adaptor BICD2 cause proximal spinal muscular atrophy with autosomal-dominant inheritance.
23664116 2013 Mutations in BICD2, which encodes a golgin and important motor adaptor, cause congenital autosomal-dominant spinal muscular atrophy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23097494 2012 Human Asunder promotes dynein recruitment and centrosomal tethering to the nucleus at mitotic entry.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20386726 2010 Bicaudal D2, dynein, and kinesin-1 associate with nuclear pore complexes and regulate centrosome and nuclear positioning during mitotic entry.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16473624 2005 Assay and properties of rab6 interaction with dynein-dynactin complexes.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14609947 2003 Bicaudal D induces selective dynein-mediated microtubule minus end-directed transport.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447383 2002 Bicaudal-D regulates COPI-independent Golgi-ER transport by recruiting the dynein-dynactin motor complex.
12401177 2002 The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
11864968 2002 Purification, cloning, and characterization of Nek8, a novel NIMA-related kinase, and its candidate substrate Bicd2.
11483508 2001 Mammalian Golgi-associated Bicaudal-D2 functions in the dynein-dynactin pathway by interacting with these complexes.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.