Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.73
PubTator Score 8.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis -1.811 1.0e-02
malignant mesothelioma 4.800 3.3e-09
osteosarcoma 1.780 3.8e-02
Atopic dermatitis -1.100 9.2e-04
adrenocortical carcinoma -1.282 2.5e-02
pancreatic ductal adenocarcinoma liver m... -2.700 3.1e-03
lung cancer 2.100 6.9e-04
colon cancer -1.400 2.7e-03
breast carcinoma -1.100 8.5e-03
fibroadenoma -1.500 3.2e-02
atypical teratoid/rhabdoid tumor -1.100 1.9e-05
subependymal giant cell astrocytoma 3.081 1.2e-02
ductal carcinoma in situ -2.900 8.8e-04
invasive ductal carcinoma -3.500 1.8e-03

Protein-protein Interaction (2)

Gene RIF (20)

PMID Text
26612412 A three-way interaction among maternal and fetal variants in BHMT2, GSTP1 and GPX3 contribute to congenital heart defects
26213999 The faster evolutionary rate of BHMT2 overall suggests that selective constraints were reduced relative to BHMT.
25846410 Multiple SNPs in BHMT and BHMT2 were identified to be associated with the occurrence of infant obstructive heart defects and interaction effects with maternal use of folic acid supplements.
21564312 No significant level of association was found with cleft lip with or without cleft palate and BHMT2 variants.
20662904 gene-gene interaction analysis revealed a significant epistatic interaction of BHMT2 (rs673752), PEMT (rs12325817), and PCYT1A (rs712012) with maternal NCL/P susceptibility.
20662904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19737740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19493349 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18457970 Common genetic variation in BHMT and BHMT2 and functionally characterized BHMT SNPs.
18427977 Observational study of genetic testing. (HuGE Navigator)
18230605 Betaine-homocysteine S-methyltransferase-2 is an S-methylmethionine-homocysteine methyltransferase.
12818402 Hyperhomocysteinemia, a risk factor for coronary diseases, can be caused by genetic mutations in BHMT2 metabolism.

AA Sequence

MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNV      1 - 70
MQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEARIKKLFRQQLEVFA     71 - 140
WKNVDFLIAEYFEHVEEAVWAVEVLKESDRPVAVTMCIGPEGDMHDITPGECAVRLVKAGASIVGVNCRF    141 - 210
GPDTSLKTMELMKEGLEWAGLKAHLMVQPLGFHAPDCGKEGFVDLPEYPFGLESRVATRWDIQKYAREAY    211 - 280
NLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARREYWENLLPAS    281 - 350
GRPFCPSLSKPDF                                                             351 - 363
//

Text Mined References (31)

PMID Year Title
26612412 2016 A Three-Way Interaction among Maternal and Fetal Variants Contributing to Congenital Heart Defects.
26213999 2015 Evolutionary Analyses and Natural Selection of Betaine-Homocysteine S-Methyltransferase (BHMT) and BHMT2 Genes.
25846410 2015 Obstructive heart defects associated with candidate genes, maternal obesity, and folic acid supplementation.
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
21564312 2011 New evidence for the role of cystathionine beta-synthase in non-syndromic cleft lip with or without cleft palate.
20662904 2010 Polymorphisms located in the region containing BHMT and BHMT2 genes as maternal protective factors for orofacial clefts.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19737740 2010 Associations of folate and choline metabolism gene polymorphisms with orofacial clefts.
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18457970 2008 Human betaine-homocysteine methyltransferase (BHMT) and BHMT2: common gene sequence variation and functional characterization.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18230605 2008 Betaine-homocysteine S-methyltransferase-2 is an S-methylmethionine-homocysteine methyltransferase.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12818402 2003 Investigations of a common genetic variant in betaine-homocysteine methyltransferase (BHMT) in coronary artery disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11087663 2000 Betaine-homocysteine methyltransferase-2: cDNA cloning, gene sequence, physical mapping, and expression of the human and mouse genes.