Property Summary

NCBI Gene PubMed Count 39
PubMed Score 100.93
PubTator Score 71.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
chronic lymphocytic leukemia -1.197 1.1e-03
malignant mesothelioma -5.900 1.8e-09
Barrett's esophagus 1.300 4.2e-02
psoriasis -2.000 4.3e-10
osteosarcoma 1.370 1.1e-02
ependymoma 1.300 5.6e-03
sonic hedgehog group medulloblastoma -3.300 6.7e-05
cystic fibrosis 2.154 8.9e-07
astrocytoma 2.300 6.6e-04
periodontitis 1.100 3.8e-22
atypical teratoid/rhabdoid tumor -2.200 9.3e-04
glioblastoma 2.000 6.3e-03
medulloblastoma, large-cell -2.900 1.0e-02
primitive neuroectodermal tumor -1.700 4.1e-02
Atopic dermatitis -1.300 5.5e-05
chronic kidney disease 1.200 3.7e-02
tuberculosis and treatment for 3 months -1.200 2.7e-04
primary pancreatic ductal adenocarcinoma 1.196 1.3e-02
non-small cell lung cancer -1.032 1.0e-04
interstitial cystitis -1.300 1.3e-03
pediatric high grade glioma 1.500 7.5e-03
nasopharyngeal carcinoma -1.200 9.4e-04
Breast cancer -3.000 1.4e-16
breast carcinoma -1.500 1.1e-25
gastric carcinoma 2.100 1.3e-02
invasive ductal carcinoma -1.600 1.4e-03
ovarian cancer 3.100 1.9e-06
pituitary cancer 1.300 1.1e-03
pancreatic cancer 1.300 3.0e-03
head and neck cancer -1.200 2.5e-02

 GO Component (1)

Gene RIF (31)

PMID Text
26710124 DEC2 is aberrantly expressed in rheumatoid arthritis tissue, it is induced by TNFalpha and not only affects the expression of genes belonging to molecular clock but also significantly impacts on the expression of IL-1beta as well as other inflammatory genes.
26391953 BHLHE40/41 are promising markers to predict the aggressiveness of each Endometrial Neoplasm case and that molecular targeting strategies involving BHLHE40/41 and SP1 may effectively regulate Endometrial Neoplasm progression.
25884381 DEC2 facilitates HIF-1alpha stabilization and promotes HIF-1 activation in osteosarcoma.
25524285 DEC2 participates in hypoxia-induced cell proliferation by functioning as a target gene of the PI3K/Akt signaling pathway and regulating the expression of c-Myc.
25446074 DEC2 regulates cellular function by modulating the expression of Twist1
25083013 BHLHE41 mutations reduce total sleep while maintaining NREM sleep and provide resistance to the effects of sleep loss; mutations that affect sleep also modify the normal inhibition of BHLHE41 of CLOCK/BMAL1 transactivation
24997474 Data suggest that SHARP1 plays a critical role in tumorigenesis and acquisition of the metastatic phenotype in endometrial cancer.
24918449 SHARP1 interacted with HIF-1alpha physically.
24561520 we find high frequency of RAS mutations in t(6;11)(q27;q23) pediatric AML and are the first to report a unique and significant differential overexpression of BHLHB3 in these patients.
24165159 GLI1 expression was immunohistochemically related positively with BHLHE41 and inversely with MLH1 in PDAC cells and precancerous lesions of the pancreas.
23637228 Sumoylation of Sharp-1 exerts an impact on chromatin structure and transcriptional repression of muscle gene expression through recruitment of G9a.
22801492 SHARP1 is required, and sufficient, to limit expression of HIF-target genes
22572381 DEC2 regulates apoptosis in oral cancer cells via regulation of pro-apoptotic factor Bim expression
22355045 results suggest that DEC2 periodically represses the promoter activity of CYP2D6, resulting in its circadian expression in serum-shocked cells
21327324 DEC2 has anti-apoptotic effects on the paclitaxel-induced apoptosis in human breast cancer MCF-7 cells.
21129405 demonstrated DEC2 expression in response to the treatment with polyinosinic-polycytidylic acid (poly IC), an authentic double-stranded RNA, in cultured human mesangial cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19679812 study identified a mutation, P385R, in DEC2 associated with a short sleep phenotype; activity profiles & sleep recordings of transgenic mice carrying this mutation showed increased vigilance time and less sleep time than control mice
18411297 DEC1, along with DEC2, plays a role in the finer regulation and robustness of the molecular clock CLOCK/BMAL1
18345027 MLH1 is transcriptionally repressed by the hypoxia-inducible transcription factors, DEC1 and DEC2.
18228528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18223678 role of the BHLHB3 protein as a tumor suppressor for lung cancer.
17194498 Observational study of gene-disease association. (HuGE Navigator)
16287852 a corepressor complex containing CtIP/CtBP facilitates RBP-Jkappa/SHARP-mediated repression of Notch target genes
12624110 DEC1-mediated repression on the expression of DEC2
12397359 Dec1 and Dec2 are regulators of the mammalian molecular clock, and form a fifth clock-gene family. [dec1]
12354771 DEC1 and DEC2 may play a crucial role in the adaptation to hypoxia

AA Sequence

MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDL      1 - 70
LPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAK     71 - 140
EVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQK    141 - 210
LEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM    211 - 280
KLDSRGGGSGGGPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLP    281 - 350
FCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS    351 - 420
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP            421 - 482
//

Text Mined References (41)

PMID Year Title
26710124 2015 Differentially Expressed in Chondrocytes 2 (DEC2) Increases the Expression of IL-1? and Is Abundantly Present in Synovial Membrane in Rheumatoid Arthritis.
26391953 2015 Regulation of the Mechanism of TWIST1 Transcription by BHLHE40 and BHLHE41 in Cancer Cells.
25884381 2015 DEC2 expression is positively correlated with HIF-1 activation and the invasiveness of human osteosarcomas.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25524285 2015 Involvement of c-Myc in the proliferation of MCF-7 human breast cancer cells induced by bHLH transcription factor DEC2.
25446074 2014 The basic helix-loop-helix (bHLH) transcription factor DEC2 negatively regulates Twist1 through an E-box element.
25083013 2014 A novel BHLHE41 variant is associated with short sleep and resistance to sleep deprivation in humans.
24997474 2014 Suppression of the epithelial-mesenchymal transition by SHARP1 is linked to the NOTCH1 signaling pathway in metastasis of endometrial cancer.
24918449 2014 SHARP1 suppresses angiogenesis of endometrial cancer by decreasing hypoxia-inducible factor-1? level.
24561520 2014 Unique BHLHB3 overexpression in pediatric acute myeloid leukemia with t(6;11)(q27;q23).
24165159 2013 GLI1 interferes with the DNA mismatch repair system in pancreatic cancer through BHLHE41-mediated suppression of MLH1.
23637228 2013 Sumoylation of the basic helix-loop-helix transcription factor sharp-1 regulates recruitment of the histone methyltransferase G9a and function in myogenesis.
22801492 2012 SHARP1 suppresses breast cancer metastasis by promoting degradation of hypoxia-inducible factors.
22572381 2012 BHLH transcription factor DEC2 regulates pro-apoptotic factor Bim in human oral cancer HSC-3 cells.
22355045 2012 Time-dependent interaction between differentiated embryo chondrocyte-2 and CCAAT/enhancer-binding protein ? underlies the circadian expression of CYP2D6 in serum-shocked HepG2 cells.
21327324 2011 Basic helix-loop-helix transcription factors DEC1 and DEC2 regulate the paclitaxel-induced apoptotic pathway of MCF-7 human breast cancer cells.
21129405 2011 Basic-helix-loop-helix transcription factor DEC2 constitutes negative feedback loop in IFN-?-mediated inflammatory responses in human mesangial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19786558 2009 The basic helix-loop-helix proteins differentiated embryo chondrocyte (DEC) 1 and DEC2 function as corepressors of retinoid X receptors.
19679812 2009 The transcriptional repressor DEC2 regulates sleep length in mammals.
18557763 2008 Phylogenetic and expression analysis of the basic helix-loop-helix transcription factor gene family: genomic approach to cellular differentiation.
18411297 2008 DEC1 modulates the circadian phase of clock gene expression.
18345027 2008 Human mismatch repair gene, MLH1, is transcriptionally repressed by the hypoxia-inducible transcription factors, DEC1 and DEC2.
18228528 2008 Clock genes may influence bipolar disorder susceptibility and dysfunctional circadian rhythm.
18223678 2008 BHLHB3: a candidate tumor suppressor in lung cancer.
17194498 2007 Common polymorphisms in D12S1034 flanking genes RASSF8 and BHLHB3 are not associated with lung adenocarcinoma risk.
16287852 2005 RBP-Jkappa/SHARP recruits CtIP/CtBP corepressors to silence Notch target genes.
15560782 2004 Functional analysis of the basic helix-loop-helix transcription factor DEC1 in circadian regulation. Interaction with BMAL1.
15193144 2004 DNA binding, but not interaction with Bmal1, is responsible for DEC1-mediated transcription regulation of the circadian gene mPer1.
14672706 2004 A novel autofeedback loop of Dec1 transcription involved in circadian rhythm regulation.
12624110 2003 DEC1 negatively regulates the expression of DEC2 through binding to the E-box in the proximal promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397359 2002 Dec1 and Dec2 are regulators of the mammalian molecular clock.
12354771 2002 Identification of functional hypoxia response elements in the promoter region of the DEC1 and DEC2 genes.
11278948 2001 The basic helix-loop-helix protein, sharp-1, represses transcription by a histone deacetylase-dependent and histone deacetylase-independent mechanism.
11162494 2001 Molecular cloning and characterization of DEC2, a new member of basic helix-loop-helix proteins.
11058868 2000 Identification of differentially expressed genes in human melanoma cells with acquired resistance to various antineoplastic drugs.