Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.61
PubTator Score 3.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 3.9e-04
astrocytic glioma -1.600 1.0e-02
ependymoma -2.100 8.9e-03
interstitial cystitis -1.200 4.9e-04
lung carcinoma 1.100 5.5e-22
malignant mesothelioma -3.100 1.6e-07
medulloblastoma, large-cell -1.600 3.1e-03
psoriasis -1.700 2.6e-04

Synonym

Accession Q6PI77 Q9C0G2 bHLHb9
Symbols GASP3
p60TRP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAGTKNKTRAQAKTEKKAAIQAKAGAEREATGVVRPVAKTRAKAKAKTGSKTDAVAEMKAVSKNKVVAET      1 - 70
KEGALSEPKTLGKAMGDFTPKAGNESTSSTCKNEAGTDAWFWAGEEATINSWFWNGEEAGNSFSTKNDKP     71 - 140
EIGAQVCAEELEPAAGADCKPRSGAEEEEEENVIGNWFWEGDDTSFDPNPKPVSRIVKPQPVYEINEKNR    141 - 210
PKDWSEVTIWPNAPAVTPAVLGFRSQAPSEASPPSYIVLASAEENACSLPVATACRPSRNTRSCSQPIPE    211 - 280
CRFDSDPCIQTIDEIRRQIRIREVNGIKPFACPCKMECYMDSEEFEKLVSLLKSTTDPLIHKIARIAMGV    281 - 350
HNVHPFAQEFINEVGVVTLIESLLSFPSPEMRKKTVITLNPPSGDERQRKIELHVKHMCKETMSFPLNSP    351 - 420
GQQSGLKILGQLTTDFVHHYIVANYFSELFHLLSSGNCKTRNLVLKLLLNMSENPTAARDMINMKALAAL    421 - 490
KLIFNQKEAKANLVSGVAIFINIKEHIRKGSIVVVDHLSYNTLMAIFREVKEIIETM                 491 - 547
//

Text Mined References (12)

PMID Year Title