Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.07
PubTator Score 16.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.6e-08

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.6e-08

Gene RIF (8)

PMID Text
22495370 noted a higher mean value of microvascular density in CK5/6 and Ep-CAM-immunopositive tumors, carcinomas with aberrant CK8/18 expression, and carcinomas with no or strong expression of MMP-2 in stromal fibroblast-like cells
22374815 Activation of protein kinase Cdelta leads to increased pancreatic acinar cell dedifferentiation in the absence of MIST1.
21907708 Chief cells emerge from the Mist.
21098683 MIST1 is enriched upon plasma cell differentiation.
20709804 Our findings implicate MIST1 as a reliable marker of mature, healthy chief cells, and we provide the first evidence that metaplasia in humans arises at least in part from the chief cell lineage.
20382342 Observational study of gene-disease association. (HuGE Navigator)
20038531 MIST1 binds to highly conserved CATATG E-boxes to directly activate transcription of 6 genes, including those encoding the small GTPases RAB26 and RAB3D.
16645041 Mist1 within the hierarchy of known helix-loop-helix/basic helix-loop-helix proteins that control mammary epithelial cell development

AA Sequence

MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR      1 - 70
DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP     71 - 140
GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT                         141 - 189
//

Text Mined References (16)

PMID Year Title
22495370 2012 MIST1-a novel marker of plasmacytic differentiation.
22374815 2012 Activation of protein kinase C? leads to increased pancreatic acinar cell dedifferentiation in the absence of MIST1.
21907708 2011 The origin of pre-neoplastic metaplasia in the stomach: chief cells emerge from the Mist.
21269460 2011 Initial characterization of the human central proteome.
21098683 2011 Transcription factor MIST1 in terminal differentiation of mouse and human plasma cells.
20709804 2010 The transcription factor MIST1 is a novel human gastric chief cell marker whose expression is lost in metaplasia, dysplasia, and carcinoma.
20382342 2010 Body mass index and von Hippel-Lindau gene mutations in clear-cell renal cancer: Results of the Netherlands Cohort Study on diet and cancer.
20038531 2010 RAB26 and RAB3D are direct transcriptional targets of MIST1 that regulate exocrine granule maturation.
18557763 2008 Phylogenetic and expression analysis of the basic helix-loop-helix transcription factor gene family: genomic approach to cellular differentiation.
16645041 2006 Identification of a basic helix-loop-helix transcription factor expressed in mammary gland alveolar cells and required for maintenance of the differentiated state.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12617822 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.