Property Summary

NCBI Gene PubMed Count 193
PubMed Score 7292.66
PubTator Score 662.74

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (172)

PMID Text
26772621 This study investigated osteocalcin, metabolic parameters and anthropometric characteristics in normal weight and overweight/obese children.
26636404 Nonalcoholic fatty liver disease negatively associated with right-hip bone mineral density and serum osteocalcin in Korean men.
26576474 The aims of this study were to evaluate OCN and sclerostin levels in subjects who underwent coronary artery bypass graft (CABG) surgery compared with those in normal controls.
26567728 Serum osteocalcin levels are inversely correlated with nonalcoholic fatty liver disease in postmenopausal Chinese women with normal blood glucose levels.
26381729 Serum uOC levels in non-dialysis patients with CKD are significantly lower than those in healthy individuals, and uOC is closely associated with subclinical atherosclerosis in CKD patients.
26372899 Serum total osteocalcin level is significantly lower in 2 diabetes mellitus patients than controls.
26308289 A reduced proportion of undercarboxylated osteocalcin or higher N-terminal propeptide of type I collagen are associated with increased incidence of myocardial infarction.
26166639 In obese patients, osteocalcin levels decreased after a hypocaloric diet.
26077201 Serum osteocalcin level was not independently associated with C-IMT in a metabolically healthy Chinese population.
25963022 serum level not associated with weight loss or body fat percentage
25871789 Data suggest that a low serum osteocalcin level was an independent risk factor for abdominal obesity.
25868823 Data indicate that higher osteocalcin (OC) or its undercarboxylated form (ucOC) concentration and ucOC to osteocalcin ratio (OCR) were associated with the risk of coronary calcification in men.
25855755 These findings unequivocally document that increased vitamin K intake reduces the uncarboxylated form of OCN
25816734 Data suggest that serum biomarkers of low bone turnover (osteocalcin; CrossLaps peptide/CTX; procollagen type 1 N-terminal propeptide/PINP) are down-regulated in subjects with metabolic syndrome and diabetes type 2.
25721846 findings indicate the association between serum osteocalcin and glucose metabolism and beta cell function; no relationship was found between osteocalcin and insulin resistance and lipid metabolism in type 2 diabetes
25716667 ucOC(Undercarboxylated osteocalcin ) showed an inverse correlation with markers of insulin resistance, central obesity, and the presence of MetS ( metabolic syndrome ) in postmenopausal women and appears to protect against MetS ( metabolic syndrome ).
25675353 Elevated serum preptin and decreased osteocalcin concentrations, together with insulin resistance, are associated with obesity and overweight.
25644945 Correlation between osteocalcin-positive endothelial progenitor cells and spotty calcification in patients with coronary artery disease
25587715 These findings for the first time suggest that genetic variant in osteocalcin gene rs1800247 polymorphisms may be a risk factor for hepatitis B-related hepatocellular carcinoma.
25577163 Endocrine function of osteocalcin and the cell biology events that allow osteocalcin to become a hormone. [review]
25480426 gestational diabetes is not associated with osteocalcin, under-carboxylated osteocalin, osteopontin and leptin and does not correlate with insulin resistance.
25376262 Osteocalcin has a role in the pituitary-gonadal axis in older men
25327813 Serum osteocalcin is negatively associated with weight BMI and fasting plasma glucose in healthy Chinese women.
25224152 In chronic kidney disease, patients with mitral annular calcification had higher serum osteocalcin levels.
25195811 Serum total osteocalcin level was not associated with the development of cardiovascular disease.
25174991 exercise-induced body fat reduction and improved insulin sensitivity were accompanied by an increase in serum osteocalcin and leptin levels
25068814 OC follows a gene duplication strategy while MGP variability was obtained mostly by the use of multiple promoters and alternative splicing, leading to proteins with additional functional characteristics and alternative gene regulatory pathways. [review]
25050899 cross-linked C-telopeptide of type 1 collagen, body mass index, creatinine, Sema3A, bone mineral densities, and age were determinants of Ocn
24896339 Data indicate that Ca2+ binding triggered a similar conformational transition in both gamma-carboxyglutamic acid-containing protein osteocalcin (Gla-OCN) and Glu-OCN from a disordered structure to a more compact/stable form.
24893146 In this review, we summarize the current knowledge on osteocalcin functions, its various modes of action and the mechanisms implicated in the control of this hormone. [review]
24859912 in type 1 diabetes of long duration, OC serum levels are inversely associated with HbA1c and BMI, supporting the hypothesis that a poor glycemic control can affect osteoblast function.
24852846 No correlation between total osteocalcin and fasting plasma glucose, fasting insulin and insulin resistance parameters was found in nondiabetic postmenopausal women. Serum levels of adiponectin were associated with metabolic syndrome.
24842726 In older Caucasian men, total osteocalcin level was associated with metabolic syndrome severity. Osteocalcin was more strongly associated with MetS severity than other bone turnover markers.
24804200 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24801588 A higher plasma OC concentration was associated with a reduced risk of CVD in older-old men and with an increased risk of CVD in older-old women.
24785155 Osteocalcin might improve glucose metabolism through enhancing insulin secretion in males, and through increasing insulin secretion and improving insulin resistance in females with type 2 diabetes mellitus.
24606073 Total OC and carboxylated OC showed less pronounced decrease during the oral glucose tolerance test in obese subjects compared with controls, whereas other bone turnover markers responded similarly in the two groups.
24583540 We found that one bout of severe eccentric contractions caused increases in osteocalcin and TRACP-5b
24529156 The undercarboxylated form of OC is related to common cardiovascular risk markers in children at risk for cardiovascular disease.
24503413 Data suggest plasma osteocalcin can be regulated by diet; osteocalcin levels are lower with high-protein/high-glycemic index (GI) diet than with low-protein/high-GI diet after 6-month family intervention in children/adolescents of overweight parents.
24465160 Serum osteocalcin is associated with indices of obesity and HDL level in men
24455828 Results indicate a significant correlation between Glu-OC and assessed markers of bone metabolism. 2. Research has indicated a link between bone metabolism and the degree of calcification in the coronary arteries.
24405382 protective action of osteocalcin against the development of insulin resistance and type 2 diabetes in women may be partially mediated through up-regulation of adiponectin secretion
24339141 Data suggest that serum osteocalcin levels are down-regulated in newly diagnosed, middle-aged, Tibetan men with different degrees of glucose tolerance in association with poorer insulin resistance and poorer pre-treatment control of blood glucose.
24219294 Activation of IGF-1R can induce apoptosis in adipose-derived stem cells, whereas it can be prevented by the A20 and osteocalcin expression.
24167545 an inverse association between serum ferritin and sTfR with osteocalcin and extend previous results on adiponectin, thus supporting that factors related to iron metabolism could contribute to the insulin resistance and the development of type 2 diabetes
24113735 The uncarboxylated to carboxylated index of osteocalcin is low in type 2 diabetes patients.
24078129 Engineered a recombinant human osteocalcin (rhOC) with FN type III9-14 (rhOC-FNIII9-14) containing RGD and HBD to promote the cellular activity of MC3T3-E1 cells, including adhesion, proliferation, and differentiation.
24037881 In a population at high cardiovascular risk, low concentrations of serum carboxylated OC and uccarboxylated OC were strongly associated with an increased risk of incident diabetes.
23788330 There are 3 ERRalpha response elements (ERR response element, ERRE) in the osteocalcin promoter, and ERRalpha interacted cooperatively with PGC-1alpha could improve the osteocalcin promoter activity.
23696116 Data do not support the notion that osteocalcin is associated with male fertility in young men from infertile couples.
23616149 Data from overweight/obese patients suggest that serum total OC is associated with skeletal muscle but not hepatic insulin resistance; undercarboxylated OC is associated with islet beta-cell function only in individuals with impaired fasting glucose.
23553865 Data suggest that serum level of total osteocalcin during the follicular phase is positively associated with fat-free mass in healthy premenopausal women.
23512417 Circulating UC-OCN was increased while C-OCN was decreased in treatment-naive females with metabolic syndrome.
23485732 Data suggest that lower serum OCN is associated with metabolic syndrome (MS); serum OCN is inversely associated with body mass index, waist circumference, and hypertension, suggesting that OCN plays a part in development/progression of MS/overweight.
23386651 Higher baseline total osteocalcin concentrations were associated with lower abdominal aorta calcification progression rate and lower mortality.
23342952 Serum osteocalcin is an independent risk factor for carotid atherosclerosis in patients with type 2 diabetes.
23261860 Is there an association between insulin resistance and serum osteocalcin (or adiponectin) levels? Data from obese children/adolescents in Turkey suggest no association between serum osteocalcin (or adiponectin) levels and insulin resistance.
23206207 Osteocalcin is released from platelet granules and is expressed and released at a higher concentration in patients with carotid artery occlusive disease.
23162093 Serum osteocalcin levels were inversely correlated with visceral fat area in Chinese men.
23137636 the polymorphic genotypes of BGLAP, ER1, Col1A1 and CALCR are not found to be associated with osteoporosis in a single form but found to be associated in combined forms.
23135318 High Serum undercarboxylated osteocalcin level is associated with response to therapy in rheumatoid arthritis.
23001602 Our study indicates that the serum ucOC decreases with age in men, increases postmenopausally in women, and correlates inversely with dietary consumption of certain foods and with fasting glucose and HbA1c level.
22978420 Osteocalcin may play a protective role in the pathogenesis of type 2 diabetes
22842327 Bioinformatics sources suggest that the aforementioned interaction could originate from different genetic loci in the osteocalcin region; however, ascertaining the exact circumstances requires a detailed molecular-genetic study
22773701 The serum osteocalcin level was not associated with the development of type 2 diabetes in middle-aged males.
22752126 serum osteocalcin levels were independently associated with glucose intolerance and abdominal obesity, which are components of metabolic syndrome, and type 2 diabetes mellitus in postmenopausal women in Iran
22735266 These findings indicate that hBGP expression in osteoblasts resulted in the abnormal skeletal growth in the mice.This study provides a valuable model for understanding the fundamental role of BGP in vivo.
22679141 Skeletal hormone osteocalcin cross-talks with vascular system and contributes to vascular remodeling via angiotensin II, Toll-like receptor (TLR)4, and cyclooxygenase (COX)-2.
22652825 A significant increase of osteocalcin after physical exercise was found in subjects with adrenal incidentaloma.
22615158 Metabolic activity of bone and energy-related organs like fat and islets are closely linked by circulating osteocalcin (OCN). Through systemic release of OCN, bone delivers its energy-demanding information to other organs to satisfy its energy requirement
22577088 In female adolescents, BMI is inversely related to osteocalcin.
22517558 The results showed that both OC and TRACP-5b values were at their highest during the ovulation period, and the activity of TRACP-5b was more significant than that of OC. Furthermore, the changes in sex hormone secretion involved in OC and TRACP-5b showed specific patterns during the menstrual cycle.
22294259 The levels of serum undercarboxylated osteocalcin (5.66+/-4.70 ng/ml) as well as other cartilage metabolism markers, were elevated in the patients with bilateral knee osteoarthritis.
22219025 Data suggest that serum osteocalcin (OC) might be a sensitive biomarker for detecting early stages of dental fluorosis.
22136751 investigation of whether uncarboxylated osteocalcin acts as hormone to improve glucose handling and reduce fat mass; investigation of whether elevated serum uncarboxylated osteocalcin is associated with higher body weight and adiposity
22102412 BMP2 induces osteoblast differentiation through Runx2-dependent ATF6 expression, which directly regulates Oc transcription.
22068892 Adiposity measures were inversely correlated with osteocalcin and intact parathyroid hormone, whereas such relationships were not observed for vitamin D.
22068385 in type 1 diabetes, undercarboxylated osteocalcin appears to correlate positively with markers of insulin exposure, either endogenously produced or exogenously administered
22034088 Collagen type XV and osteocalcin expression are highly sensitive markers to extracellular calcium
21968268 Serum OC and NTx levels may be useful markers of serum iPTH levels for evaluating bone turnover in HD patients and may eventually prove useful in the management of patients with CKD-MBD.
21964930 Osteocalcin gene expression is regulated by wild-type p53
21944272 No significant differences in osteocalcin concentrations were observed between rine growth restriction and appropriate-for-gestational-age groups
21935388 omentin-1 serum levels are correlated with BMD at the femoral neck and the serum levels of osteocalcin and osteopontin in MS patients
21713451 The mRNA expression of type I collagen, ALP, osteocalcin and RUNX2 increased markedly in human adipose stem cells as a result of lactoferrin treatment.
21590731 In human males, the bone-testis axis may be most relevant during rapid skeletal growth, when T levels are rising under the influence of the hypothalamic-pituitary axis and OCN is increasing due to skeletal growth.
21558934 RT-PCR showed that BGLAP from osteoblasts from Pfeiffer syndrome grown on PLPG acid plates were upregulated after 30 days.
21521333 Serum osteocalcin is inversely associated with the metabolic syndrome as well as the severity of coronary atherosclerosis in Chinese men, supporting the new concept that bone has the reciprocal regulation with energy metabolism.
21521304 Obese patients with type 2 diabetes showed significantly reduced levels of OC in comparison with patients with lower degrees of glucose tolerance derangement.
21487672 Recombinant human bone morphogenic protein-7 and osteogenic differentiation medium up-regulated osteocalcin in human bone-marrow-derived mesenchymal stem cells in vitro.
21427224 Data show that osteocalcin synthesis was significantly reduced in the stable HSP27-transfected MC3T3-E1 cells and normal human osteoblasts.
21425331 These findings suggest that GPRC6A is a candidate for mediating the response to Ocn in the bone-pancreas endocrine loop regulating insulin signaling.
21353261 In a Chinese male population, we firstly identified an inverse association of serum osteocalcin levels with the metabolic syndrome, independent from the well-known metabolic syndrome risk factors.
21333348 Findings expand the biological importance of osteocalcin, begin to unravel its molecular mode of action, and provide the first evidence that the skeleton is an endocrine regulator of fertility.
21301010 Osteocalcin is associated with liver fibrosis in nonalcoholic fatty liver disease, but this association disappears in a multivariate analysis.
21292339 Data conclude that circulating osteocalcin and leptin are related to glucose intolerant state.
21178793 In healthy postmenopausal women, there was a consistent association between osteocalcin and markers of metabolic syndrome.
21169728 Adiponectin correlates with osteocalcin and fat free mass, and osteocalcin is related to insulin, glucose and insulin resistance in a study of female rowers.
21153019 In a sample of Koreans, osteocalcin was associated with metabolic syndrome independently of glucose metabolism
20831864 Osteocalcin was inversely related to visceral obesity in Korean obese and overweight men.
20694489 Lower osteocalcin and elevated serum levels of its carboxylated form are displayed in PCOS subjects and are associated with several PCOS components.
20625700 A decrease of osteopontin and osteocalcin in bone is important for promoting vulnerability to hip fracture.
20592451 Single nucleotide polymorphisms in osteocalcin was not associated with type 2 diabetes.
20592451 Observational study of gene-disease association. (HuGE Navigator)
20587710 significant association between osteocalcin levels and A-FABP in metabolic syndrome
20577791 investigated whether chronic periodontitis patients exhibit different plasma concentrations of C-telopeptide pyridinoline cross-links of type I collagen (ICTP) and osteocalcin (OC) compared to the clinically healthy controls
20574675 An acute increase in osteocalcin concentration, elicited by a physiological intervention (prolonged exercise) is associated with a reduction in circulating leptin levels and insulin resistance in lean well-trained triathletes.
20501596 Osteocalcin may lie in the causal pathway between central adiposity and insulin resistance.
20433876 The Ad-leptin up-regulated osteocalcin expression.
20410230 Our data support a pathophysiological link between undercarboxylated osteocalcin and carboxylated osteocalcin balance and obesity
20395593 Serum osteocalcin is associated with measures of insulin resistance, adipokine levels, and the presence of metabolic syndrome.
20355242 alkaline phosphatase, IL-6, TNF-alpha, and bilirubin, but not IGF-1 or osteocalcin may play a role in hepatic osteodystrophy and liver cirrhosis
20305683 The HindIII polymorphism of the osteocalcin gene, but not the PvuII polymorphism of the estrogen receptor alpha gene or their potential interaction, was associated with body mass index in premenopausal Chinese women.
20305683 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20221651 These results indicate that older age, a greater number of prevalent fractures and higher undercarboxylated osteocalcin levels, and lower lumbar bone mineral density are risks for incident fractures despite use of amino-bisphosphonates.
20200947 Polymorphisms in and around the osteocalcin locus are significantly associated with serum-TotalOC and fracture.
20200947 Observational study of gene-disease association. (HuGE Navigator)
20157712 A positive association is found between serum level of osteocalcin and severity of hand osteoarthritis, in a cross-sectional population-based study.
19877133 Elevated plasma osteocalcin is associated with improved glucose tolerance. Elevated uncarboxylated osteocalcin is associated with enhanced beta-cell function; elevated carboxylated osteocalcin is associated with improved insulin sensitivity.
19856264 Data show that the gradual process of osteogenesis can be followed by different proteins being expressed at various time points, comprising early bone-specific alkaline phosphatase (bALP)) and late gene osteocalcin.
19767102 not associated with dental fluorosis
19767102 Observational study of gene-disease association. (HuGE Navigator)
19751417 Prevalence of osteopenia and relationships between osteocalcin, bone alkaline phosphatase, and bone mineral density in patients with insulin-dependent diabetes mellitus.
19751416 Relationship between bone formation markers osteocalcin and bone-specific alkaline phosphatase and age in postmenopausal women.
19732762 Data suggest taht serial measurements of osteocalcin could be useful in the detection of bone metastases from differentiated thyroid carcinoma.
19641839 The OC/BAP ratio could be clinically useful for assessing the risk of vertebral fractures independent of BMD in diabetic men.
19595020 strain enhance expression of osteocalcin, type I collagen gene and Cbfa1/Runx2 in human osteoblas
19453261 Observational study of gene-disease association. (HuGE Navigator)
19136823 Protein levels and mRNA expression of osteocalcin were greater in calcified compared to noncalcified plaques.
19088165 serum osteocalcin concentration was inversely associated with markers of dysmetabolic phenotype & measures of adiposity; results provide support for important role of osteocalcin to regulate glucose tolerance, insulin sensitivity & systemic inflammation
19063687 Plasma osteocalcin is inversely related to fat mass and plasma glucose.
19031822 Exposure of odontoblast-like cells to LPS decreases osteocalcin gene expression.
18657532 There is a potential role of osteocalcin in regulating blood glucose levels in postmenopausal women
18551993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18496130 Observational study of gene-disease association. (HuGE Navigator)
18321663 In cotransfection experiments with an osteocalcin (OC) promoter construct, we confirmed that only RUNX2wt and RUNX2Delta7 could upregulate the OC promoter activity in the osteosarcoma cell line.
18285546 Observational study of gene-disease association. (HuGE Navigator)
18171674 TFIIA gamma together with ATF4 and Runx2 stimulates osteocalcin promoter activity and endogenous mRNA expression.
18163903 BGLAP is expressed in pancreatic cancer cells and increases their growth and invasion
18160010 HIV-1 Gag reduces osteoblast function and significantly reduces the levels of BMP-2, BMP-7, osteocalcin, and RANK-L
17889845 Combined use of osteocalcin and beta-CTX could be useful in early detection of bone metastatic breast cancer which might improve the outcome of the disease.
17627084 Observational study of gene-disease association. (HuGE Navigator)
17627084 Our data do not support the BGP gene having a major effect on BMD variation in pre-menopausal Chinese women.
17254772 local 1,25D synthesis has paracrine effects in the bone microenvironment implying that vitamin D metabolism in human osteoblasts represents a physiologically important pathway
17252541 Data show that simvastatin and atorvastatin enhance gene expression of collagen type 1 and osteocalcin in primary human osteoblasts and MG-63 cultures.
17242729 Serum osteocalcin showed no significant difference with the control healthy subjects.
17000892 The transcription axis of osteocalcin is crucial in maintaining equilibrium of bone formation and resorption. Heparin affects expression in osteoblast culture.
16735944 Observational study of gene-disease association. (HuGE Navigator)
16412323 Observational study of gene-disease association. (HuGE Navigator)
16387359 mRNA and protein are expressed in c-KIT positive neoplastic stem cells in hematological malignancies.
16263577 May be a biological markers of bone disease in multiple myeloma.
15753298 the osteocalcin sequences of Neanderthals, modern human, chimpanzee, and orangutan are unusual among mammals in that the ninth amino acid is proline (Pro-9), whereas most species have hydroxyproline (Hyp-9)
15562030 Low serum level in osteochondrodysplasia.
15108070 Observational study of gene-disease association. (HuGE Navigator)
15108070 HindIII RFLP of the BGP gene may be limited as a genetic marker to discern women susceptible to low BMD and thus osteoporosis in Chinese
15108065 relationship between increase in undercarboxylated osteocalcin levels and low bone mineral density in elderly women with type II diabetes mellitus
12879219 Observational study of gene-disease association. (HuGE Navigator)
12843190 Observational study of gene-disease association. (HuGE Navigator)
12843190 osteocalcin genes are susceptibility loci for reduced bone mineral density in postmenopausal women
12674332 Telomerase accelerates osteogenesis of bone marrow stromal stem cells by upregulation of CBFA1, osterix, and osteocalcin.
12565780 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12393937 This protein is regulated by human basic fibroblast growth factor.
12270142 TWIST inactivation reduces CBFA1/RUNX2 expression and DNA binding to its promoter in osteoblasts
12145306 Expression is regulated by a novel Ku antigen transcription factor complex
12112004 Differential regulation of Cbfa1/Runx2 and osteocalcin gene expression by vitamin-D3, dexamethasone, and local growth factors in primary human osteoblasts
11979972 exists in osteoblasts and suppresses excess calcification
11918225 Observational study of gene-disease association. (HuGE Navigator)
11918225 data support the BGP gene as a quantitative trait locus(QTL)underlying hip bone mineral density variation variation
11856645 Osteocalcin was not localized extracellularly within the collagen-rich dentin matrix (predentin or intertubular dentin), but was found in the mature enamel.
11574953 Observational study of gene-disease association. (HuGE Navigator)
11396736 Observational study of gene-disease association. (HuGE Navigator)
11199188 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR      1 - 70
REVCELNPDCDELADHIGFQEAYRRFYGPV                                             71 - 100
//

Text Mined References (195)

PMID Year Title
26772621 2016 Different osteocalcin forms, markers of metabolic syndrome and anthropometric measures in children within the IDEFICS cohort.
26636404 2016 Association of nonalcoholic fatty liver disease with bone mineral density and serum osteocalcin levels in Korean men.
26576474 2016 Lower uncarboxylated osteocalcin and higher sclerostin levels are significantly associated with coronary artery disease.
26567728 2015 Inverse relationship between serum osteocalcin levels and nonalcoholic fatty liver disease in postmenopausal Chinese women with normal blood glucose levels.
26381729 2015 Undercarboxylated osteocalcin as a biomarker of subclinical atherosclerosis in non-dialysis patients with chronic kidney disease.
26372899 2015 Association between Serum Total Osteocalcin Level and Type 2 Diabetes Mellitus: A Systematic Review and Meta-Analysis.
26308289 2015 Proportion of Undercarboxylated Osteocalcin and Serum P1NP Predict Incidence of Myocardial Infarction in Older Men.
26166639 2015 Response of osteocalcin and insulin resistance after a hypocaloric diet in obese patients.
26089135 2015 Association between osteocalcin and glucose metabolism: a meta-analysis.
26078267 2015 Global miRNA expression and correlation with mRNA levels in primary human bone cells.
26077201 2015 Relationship between serum osteocalcin level and carotid intima-media thickness in a metabolically healthy Chinese population.
25963022 2015 Osteocalcin carboxylation is not associated with body weight or percent fat changes during weight loss in post-menopausal women.
25955226 2015 The Effect of Treatment With PTH on Undercarboxylated Osteocalcin and Energy Metabolism in Hypoparathyroidism.
25932680 2015 Osteocalcin regulates murine and human fertility through a pancreas-bone-testis axis.
25871789 2015 Association between serum osteocalcin level and visceral obesity in Chinese postmenopausal women.
25868823 2015 Coronary artery calcification is associated with high serum concentration of undercarboxylated osteocalcin in asymptomatic Korean men.
25855755 2015 Gamma-carboxylation and fragmentation of osteocalcin in human serum defined by mass spectrometry.
25816734 2015 Lower bone turnover markers in metabolic syndrome and diabetes: the population-based Study of Health in Pomerania.
25809656 2015 An overview of the metabolic functions of osteocalcin.
25738584 2015 Local origins impart conserved bone type-related differences in human osteoblast behaviour.
25721846 2015 The Relationship between Serum Osteocalcin Concentration and Glucose and Lipid Metabolism in Patients with Type 2 Diabetes Mellitus – The Role of Osteocalcin in Energy Metabolism.
25716667 2015 Association between osteocalcin and metabolic syndrome in postmenopausal women.
25675353 2015 Relationships between preptin and osteocalcin in obese, overweight, and normal weight adults.
25644945 2015 Correlation between osteocalcin-positive endothelial progenitor cells and spotty calcification in patients with coronary artery disease.
25587715 2015 Relationships between the Osteocalcin gene polymorphisms, serum osteocalcin levels, and hepatitis B virus-related hepatocellular carcinoma in a Chinese population.
25577163 2015 An overview of the metabolic functions of osteocalcin.
25538061 2015 Identification of two populations of osteoarthritic osteoblasts according to the 1,25[OH]? vitamin D? potency to stimulate osteocalcin.
25480426 2015 Osteocalcin, under-carboxylated osteocalcin and osteopontin are not associated with gestational diabetes mellitus but are inversely associated with leptin in non-diabetic women.
25416346 2015 Osteocalcin: an osteoblast-derived polypeptide hormone that modulates whole body energy metabolism.
25376262 2015 Osteocalcin and the pituitary-gonadal axis in older men: a population-based study.
25365314 2015 Higher serum undercarboxylated osteocalcin and other bone turnover markers are associated with reduced diabetes risk and lower estradiol concentrations in older men.
25327813 2014 Serum osteocalcin levels are inversely associated with plasma glucose and body mass index in healthy Chinese women.
25325424 2014 Broadening the role of osteocalcin in Leydig cells.
25279794 2014 Osteocalcin protects against nonalcoholic steatohepatitis in a mouse model of metabolic syndrome.
25224152 2014 Mitral annular calcification and the serum osteocalcin level in patients with chronic kidney disease.
25195811 2015 Association between the circulating total osteocalcin level and the development of cardiovascular disease in middle-aged men: a mean 8.7-year longitudinal follow-up study.
25174991 2015 The effects of aerobic exercise training on serum osteocalcin, adipocytokines and insulin resistance on obese young males.
25163392 2014 Low-dose menaquinone-4 improves ?-carboxylation of osteocalcin in young males: a non-placebo-controlled dose-response study.
25134387 2014 Reference interval for osteocalcin in Chinese Han ethnic males from the Fangchenggang Area Male Health and Examination Survey.
25093461 2014 Uncarboxylated osteocalcin stimulates 25-hydroxy vitamin D production in Leydig cell line through a GPRC6a-dependent pathway.
25068814 2014 Matrix Gla protein and osteocalcin: from gene duplication to neofunctionalization.
25050899 2014 Serum Sema3A is in a weak positive association with bone formation marker osteocalcin but not related to bone mineral densities in postmenopausal women.
24896339 2014 Carboxylation-dependent conformational changes of human osteocalcin.
24893146 2014 Regulation of energy metabolism by the skeleton: osteocalcin and beyond.
24859912 2014 Osteocalcin levels are inversely associated with Hba1c and BMI in adult subjects with long-standing type 1 diabetes.
24852846 2014 The association of osteocalcin and adiponectin with glucose metabolism in nondiabetic postmenopausal women.
24842726 2014 Lower serum osteocalcin is associated with more severe metabolic syndrome in elderly men from the MINOS cohort.
24804200 2014 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24801588 2014 Plasma osteocalcin levels as a predictor of cardiovascular disease in older men and women: a population-based cohort study.
24785155 2014 Differential pattern for regulating insulin secretion, insulin resistance, and lipid metabolism by osteocalcin in male and female T2DM patients.
24606073 2014 Suppressed bone turnover in obesity: a link to energy metabolism? A case-control study.
24583540 2014 High force eccentric exercise enhances serum tartrate-resistant acid phosphatase-5b and osteocalcin.
24529156 2014 Undercarboxylated osteocalcin relates to cardiovascular risk markers in offspring of families with metabolic syndrome.
24503413 2014 Effects of dietary protein and glycaemic index on biomarkers of bone turnover in children.
24465160 2014 Serum osteocalcin is significantly related to indices of obesity and lipid profile in Malaysian men.
24455828 2013 [Undercarboxylated osteocalcin (Glu-OC) bone metabolism and vascular calcification in hemodialyzed patients].
24405382 2014 Role of adiponectin in mediating the association of osteocalcin with insulin resistance and type 2 diabetes: a cross sectional study in pre- and post-menopausal women.
24339141 2014 Osteocalcin is inversely associated with glucose levels in middle-aged Tibetan men with different degrees of glucose tolerance.
24219294 2013 A combination of insulin and ubiquitin A20 promotes osteocalcin expression in adipose-derived stem cells.
24167545 2013 Association between serum ferritin and osteocalcin as a potential mechanism explaining the iron-induced insulin resistance.
24113735 2014 A cut-point value of uncarboxylated to carboxylated index is associated with glycemic status markers in type 2 diabetes.
24078129 2013 Impact of heparin-binding domain of recombinant human osteocalcin-fibronectinIII9-14 on the osteoblastic cell response.
24037881 2013 Reduced serum concentrations of carboxylated and undercarboxylated osteocalcin are associated with risk of developing type 2 diabetes mellitus in a high cardiovascular risk population: a nested case-control study.
23788330 2013 Estrogen-related receptor alpha interacts cooperatively with peroxisome proliferator-activated receptor-gamma coactivator-1alpha to regulate osteocalcin gene expression.
23696116 2013 Osteocalcin is not a strong determinant of serum testosterone and sperm count in men from infertile couples.
23616149 2013 Associations of total and undercarboxylated osteocalcin with peripheral and hepatic insulin sensitivity and ?-cell function in overweight adults.
23553865 2013 An independent positive relationship between the serum total osteocalcin level and fat-free mass in healthy premenopausal women.
23512417 2013 Elevated undercarboxylated and reduced carboxylated osteocalcin are associated with metabolic syndrome in middle age Asian females.
23485732 2013 Metabolic syndrome and central fat distribution are related to lower serum osteocalcin concentrations.
23386651 2013 Higher serum osteocalcin is associated with lower abdominal aortic calcification progression and longer 10-year survival in elderly men of the MINOS cohort.
23342952 2013 Serum osteocalcin level and its association with carotid atherosclerosis in patients with type 2 diabetes.
23261860 2012 Relationships between osteocalcin, glucose metabolism, and adiponectin in obese children: Is there crosstalk between bone tissue and glucose metabolism?
23206207 2013 Platelets express and release osteocalcin and co-localize in human calcified atherosclerotic plaques.
23162093 2013 Inverse relationship between serum osteocalcin levels and visceral fat area in Chinese men.
23137636 2013 Association between osteoporosis and polymorphisms of the bone Gla protein, estrogen receptor 1, collagen 1-A1 and calcitonin receptor genes in Turkish postmenopausal women.
23135318 2012 Serum undercarboxylated osteocalcin level increases with 48 weeks of teriparatide treatment in pre-treated elderly rheumatoid arthritis patients who use anti-resorptive drugs.
23001602 2013 The serum undercarboxylated osteocalcin level and the diet of a Japanese population: results from the Kyushu and Okinawa Population Study (KOPS).
22978420 2012 Relationship of serum osteocalcin levels with blood glucose, insulin resistance and lipid profile in central Indian men with type 2 diabetes.
22842327 2012 Significant association between body composition phenotypes and the osteocalcin genomic region in normative human population.
22773701 2012 Circulating osteocalcin level is not associated with incident type 2 diabetes in middle-aged male subjects: mean 8.4-year retrospective follow-up study.
22752126 2012 Reduced serum osteocalcin concentrations are associated with type 2 diabetes mellitus and the metabolic syndrome components in postmenopausal women: the crosstalk between bone and energy metabolism.
22735266 2012 Conditional expression of human bone Gla protein in osteoblasts causes skeletal abnormality in mice.
22679141 2012 From skeleton to cytoskeleton: osteocalcin transforms vascular fibroblasts to myofibroblasts via angiotensin II and Toll-like receptor 4.
22652825 2012 Effect of physiological exercise on osteocalcin levels in subjects with adrenal incidentaloma.
22615158 2012 Bone delivers its energy information to fat and islets through osteocalcin.
22577088 2012 Osteocalcin is independently associated with body mass index in adolescent girls.
22517558 2012 A change of osteocalcin (OC) and tartrate resistant acid phosphatase 5b (TRACP-5b) with the menstrual cycle.
22294259 2012 Relationship between serum undercarboxylated osteocalcin and hyaluronan levels in patients with bilateral knee osteoarthritis.
22219025 2012 The relationship of PTH Bst BI polymorphism, calciotropic hormone levels, and dental fluorosis of children in China.
22136751 2012 Association of vitamin K status with adiponectin and body composition in healthy subjects: uncarboxylated osteocalcin is not associated with fat mass and body weight.
22102412 2012 BMP2 protein regulates osteocalcin expression via Runx2-mediated Atf6 gene transcription.
22068892 2012 Vitamin D, osteocalcin, and risk for adiposity as comorbidities in middle school children.
22068385 2012 Determinants of undercarboxylated and carboxylated osteocalcin concentrations in type 1 diabetes.
22034088 2012 Extracellular calcium chronically induced human osteoblasts effects: specific modulation of osteocalcin and collagen type XV.
21968268 2011 Correlation of new bone metabolic markers with conventional biomarkers in hemodialysis patients.
21964930 2011 Osteocalcin gene expression is regulated by wild-type p53.
21944272 2012 Intrauterine growth restriction may not suppress bone formation at term, as indicated by circulating concentrations of undercarboxylated osteocalcin and Dickkopf-1.
21935388 2011 Correlation of circulating omentin-1 with bone mineral density in multiple sclerosis: the crosstalk between bone and adipose tissue.
21713451 2012 Effect of lactoferrin on osteogenic differentiation of human adipose stem cells.
21590731 2011 Relationship of testosterone and osteocalcin levels during growth.
21558934 2011 Biological effect of resorbable plates on normal osteoblasts and osteoblasts derived from Pfeiffer syndrome.
21521333 2011 Serum levels of osteocalcin are inversely associated with the metabolic syndrome and the severity of coronary artery disease in Chinese men.
21521304 2011 Serum concentrations of osteocalcin, procollagen type 1 N-terminal propeptide and beta-CrossLaps in obese subjects with varying degrees of glucose tolerance.
21487672 2011 Synergistic effect of recombinant human bone morphogenic protein-7 and osteogenic differentiation medium on human bone-marrow-derived mesenchymal stem cells in vitro.
21427224 2011 Regulation by heat shock protein 27 of osteocalcin synthesis in osteoblasts.
21425331 2011 GPRC6A mediates responses to osteocalcin in ?-cells in vitro and pancreas in vivo.
21353261 2011 Low serum osteocalcin level is a potential marker for metabolic syndrome: results from a Chinese male population survey.
21333348 2011 Endocrine regulation of male fertility by the skeleton.
21301010 Relation of osteocalcin with insulin resistance and histopathological changes of non alcoholic fatty liver disease.
21292339 2011 Circulating osteocalcin is increased in early-stage diabetes.
21178793 2011 Osteocalcin as a marker of metabolic risk in healthy postmenopausal women.
21169728 2011 Adiponectin and bone metabolism markers in female rowers: eumenorrheic and oral contraceptive users.
21153019 2011 The association between serum osteocalcin levels and metabolic syndrome in Koreans.
20831864 2010 Serum osteocalcin is related to abdominal obesity in Korean obese and overweight men.
20694489 2011 Serum concentrations of carboxylated osteocalcin are increased and associated with several components of the polycystic ovarian syndrome.
20625700 2011 Lower osteocalcin and osteopontin contents of the femoral head in hip fracture patients than osteoarthritis patients.
20592451 2010 Analysis of osteocalcin as a candidate gene for type 2 diabetes (T2D) and intermediate traits in Caucasians and African Americans.
20587710 2010 Serum osteocalcin is inversely associated with adipocyte-specific fatty acid-binding protein in the Korean metabolic syndrome research initiatives.
20577791 2011 Plasma levels of C-telopeptide pyridinoline cross-links of type I collagen and osteocalcin in chronic periodontitis.
20574675 2010 Osteocalcin as a negative regulator of serum leptin concentration in humans: insight from triathlon competitions.
20501596 2010 Reduced serum total osteocalcin is associated with metabolic syndrome in older men via waist circumference, hyperglycemia, and triglyceride levels.
20433876 2010 Osteogenic differentiation of bone marrow mesenchymal stem cells by adenovirus-mediated expression of leptin.
20410230 2010 Evidence for osteocalcin production by adipose tissue and its role in human metabolism.
20395593 2010 Serum osteocalcin is associated with measures of insulin resistance, adipokine levels, and the presence of metabolic syndrome.
20355242 2010 Hepatic osteodystrophy and liver cirrhosis.
20305683 2010 Association analysis of genetic polymorphisms and potential interaction of the osteocalcin (BGP) and ER-alpha genes with body mass index (BMI) in premenopausal Chinese women.
20221651 2010 High level of serum undercarboxylated osteocalcin in patients with incident fractures during bisphosphonate treatment.
20200947 2010 Osteocalcin gene polymorphisms influence concentration of serum osteocalcin and enhance fracture identification.
20157712 2010 Radiographic hand osteoarthritis and serum levels of osteocalcin: cross-sectional study.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19877133 2009 The uncarboxylated form of osteocalcin is associated with improved glucose tolerance and enhanced beta-cell function in middle-aged male subjects.
19856264 2009 Correlating cell architecture with osteogenesis: first steps towards live single cell monitoring.
19767102 2009 The association between osteocalcin gene polymorphism and dental fluorosis among children exposed to fluoride in People's Republic of China.
19751417 2009 Bone mineral density, osteocalcin, and bone-specific alkaline phosphatase in patients with insulin-dependent diabetes mellitus.
19751416 2009 Changes of bone formation markers osteocalcin and bone-specific alkaline phosphatase in postmenopausal women with osteoporosis.
19732762 2010 Predictive value of osteocalcin in bone metastatic differentiated thyroid carcinoma.
19641839 2009 Serum osteocalcin/bone-specific alkaline phosphatase ratio is a predictor for the presence of vertebral fractures in men with type 2 diabetes.
19595020 2009 [Human osteoblasts response to different magnitudes of mechanical stimulation in vitro].
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19136823 2009 Human carotid plaque calcification and vulnerability. Relationship between degree of plaque calcification, fibrous cap inflammatory gene expression and symptomatology.
19088165 2009 Association between serum osteocalcin and markers of metabolic phenotype.
19063687 2009 Plasma osteocalcin is inversely related to fat mass and plasma glucose in elderly Swedish men.
19031822 2008 [Effect of Escherichia coli lipopolysaccharide on mineralized matrix formation in vitro differentiation human dental pulp cell].
18657532 2008 Relationship between osteocalcin and glucose metabolism in postmenopausal women.
18551993 2008 SNP combinations in chromosome-wide genes are associated with bone mineral density in Taiwanese women.
18496130 2008 Genetic predictors of glucocorticoid-induced hypertension in children with acute lymphoblastic leukemia.
18321663 2008 Two of four alternatively spliced isoforms of RUNX2 control osteocalcin gene expression in human osteoblast cells.
18285546 2008 A PAI-1 (SERPINE1) polymorphism predicts osteonecrosis in children with acute lymphoblastic leukemia: a report from the Children's Oncology Group.
18171674 2008 General transcription factor IIA-gamma increases osteoblast-specific osteocalcin gene expression via activating transcription factor 4 and runt-related transcription factor 2.
18163903 2007 BGLAP is expressed in pancreatic cancer cells and increases their growth and invasion.
17889845 2007 Predictive value of osteocalcin and beta-CrossLaps in metastatic breast cancer.
17627084 No evidence of association of the osteocalcin gene HindIII polymorphism with bone mineral density in Chinese women.
17254772 2007 RNAi-mediated silencing of CYP27B1 abolishes 1,25(OH)2D3 synthesis and reduces osteocalcin and CYP24 mRNA expression in human osteosarcoma (HOS) cells.
17252541 2007 Simvastatin and atorvastatin enhance gene expression of collagen type 1 and osteocalcin in primary human osteoblasts and MG-63 cultures.
17242729 Osteocalcin and bone-specific alkaline phosphatase in sickle cell haemoglobinopathies.
17023519 2006 Evidence for auto/paracrine actions of vitamin D in bone: 1alpha-hydroxylase expression and activity in human bone cells.
17000892 2006 Cbfa-1 (Runx-2) and osteocalcin expression by human osteoblasts in heparin osteoporosis in vitro.
16735944 Relationship of osteocalcin and matrix Gla protein gene polymorphisms to serum osteocalcin levels and bone mineral density in postmenopausal Korean women.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16412323 2005 [Study of the impact of candidate genes on bone mineral density in postmenopausal women].
16387359 2006 Expression and functional significance of osteocalcin splicing in disease progression of hematological malignancies.
16263577 2005 The significance of carboxy-terminal telopeptide of type I collagen (ICTP) and osteocalcin (OC) in assessment of bone disease in patients with multiple myeloma.
15753298 2005 Osteocalcin protein sequences of Neanderthals and modern primates.
15562030 2005 Neonatal lethal osteochondrodysplasia with low serum levels of alkaline phosphatase and osteocalcin.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15108070 2004 Lack of association between the HindIII RFLP of the osteocalcin (BGP) gene and bone mineral density (BMD) in healthy pre- and postmenopausal Chinese women.
15108065 2004 Impaired gamma carboxylation of osteocalcin in elderly women with type II diabetes mellitus: relationship between increase in undercarboxylated osteocalcin levels and low bone mineral density.
12879219 2003 Gene polymorphisms, bone mineral density and bone mineral content in young children: the Iowa Bone Development Study.
12843190 2003 Association of polymorphisms of interleukin-6, osteocalcin, and vitamin D receptor genes, alone or in combination, with bone mineral density in community-dwelling Japanese women and men.
12674332 2003 Telomerase accelerates osteogenesis of bone marrow stromal stem cells by upregulation of CBFA1, osterix, and osteocalcin.
12565780 2003 Osteocalcin gene HindIII C/T polymorphism is a biomarker for prostate cancer and responsiveness to hormone therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12467198 Osteocalcin. A biochemical marker of bone turnover during puberty.
12393937 2002 Basic fibroblast growth factor autocrine loop controls human osteosarcoma phenotyping and differentiation.
12270142 2002 TWIST inactivation reduces CBFA1/RUNX2 expression and DNA binding to the osteocalcin promoter in osteoblasts.
12202187 2002 Influence of osteocalcin and collagen I on the mechanical and biological properties of Biocement D.
12145306 2002 Regulation of osteocalcin gene expression by a novel Ku antigen transcription factor complex.
12112004 2002 Differential regulation of Cbfa1/Runx2 and osteocalcin gene expression by vitamin-D3, dexamethasone, and local growth factors in primary human osteoblasts.
11979972 2002 [Recent advances in research on bone matrix proteins].
11918225 2002 Tests of linkage and/or association of genes for vitamin D receptor, osteocalcin, and parathyroid hormone with bone mineral density.
11856645 2002 Investigation of osteocalcin, osteonectin, and dentin sialophosphoprotein in developing human teeth.
11574953 2001 Relation of polymorphism in the promotor region for the human osteocalcin gene to bone mineral density and occurrence of osteoporosis in postmenopausal Chinese women in Taiwan.
11396736 2001 Osteocalcin gene Hind III polymorphism is not correlated with calcium oxalate stone disease.
11199188 2000 Osteocalcin gene polymorphism is related to bone density in healthy adolescent females.
10865224 2000 Calcitonin receptor mRNA in mononuclear leucocytes from postmenopausal women: decrease during osteoporosis and link to bone markers with specific isoform involvement.
10486212 1999 Osteocalcin: genetic and physical mapping of the human gene BGLAP and its potential role in postmenopausal osteoporosis.
10393081 1999 Osteocalcin binds tightly to the gamma-glutamylcarboxylase at a site distinct from that of the other known vitamin K-dependent proteins.
9076588 1997 Identification of peptide fragments generated by digestion of bovine and human osteocalcin with the lysosomal proteinases cathepsin B, D, L, H, and S.
7768973 1995 Osteocalcin cluster: implications for functional studies.
6967872 1980 Isolation and sequence of the vitamin K-dependent protein from human bone. Undercarboxylation of the first glutamic acid residue.
3019668 1986 Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones.
2785029 1989 Chromosomal localization of the human osteocalcin gene.
2394711 1990 Molecular structure, chromosome assignment, and promoter organization of the human matrix Gla protein gene.
2336375 1990 The cDNA and derived amino acid sequences of human and bovine bone Gla protein.