Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.75
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -4.100 1.9e-03
ependymoma -5.400 1.1e-03
oligodendroglioma -3.200 1.1e-02
glioblastoma -3.800 4.0e-06
sonic hedgehog group medulloblastoma -3.800 2.7e-06
atypical teratoid / rhabdoid tumor -4.100 5.7e-06
medulloblastoma, large-cell -5.800 3.0e-08
primitive neuroectodermal tumor -2.600 6.7e-03
non-small cell lung cancer -1.138 4.4e-05
intraductal papillary-mucinous adenoma (... -1.400 2.6e-03
intraductal papillary-mucinous carcinoma... -2.100 3.7e-03
intraductal papillary-mucinous neoplasm ... -3.900 2.9e-03
pancreatic cancer -1.100 1.0e-02
Breast cancer 2.900 2.9e-02
adult high grade glioma -4.000 3.7e-06
pilocytic astrocytoma -1.300 6.0e-03
non primary Sjogren syndrome sicca 1.100 2.5e-02
aldosterone-producing adenoma -1.055 1.4e-02
psoriasis -1.300 1.3e-57
Pneumonia -1.200 2.0e-03
sarcoidosis -1.100 3.2e-05
subependymal giant cell astrocytoma -3.993 8.7e-03
Pick disease -1.500 2.7e-03
acute myeloid leukemia -3.300 1.1e-04
ovarian cancer -3.200 6.5e-08

AA Sequence

MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDDMER      1 - 70
FMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMP                                  71 - 111
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18236150 2008 Adaptive evolution and frequent gene conversion in the brain expressed X-linked gene family in mammals.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15958283 2005 Characterization of the Bex gene family in humans, mice, and rats.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.